Cargando…
Acquired HIV drug resistance and virologic monitoring in a HIV hyper-endemic setting in KwaZulu-Natal Province, South Africa
BACKGROUND: Introduction of tenofovir (TDF) plus lamivudine (3TC) and dolutegravir (DTG) in first- and second-line HIV treatment regimens in South Africa warrants characterization of acquired HIV-1 drug resistance (ADR) mutations that could impact DTG-based antiretroviral therapy (ART). In this stud...
Autores principales: | , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8520607/ https://www.ncbi.nlm.nih.gov/pubmed/34656129 http://dx.doi.org/10.1186/s12981-021-00393-5 |
_version_ | 1784584703796314112 |
---|---|
author | Chimukangara, Benjamin Lessells, Richard J. Singh, Lavanya Grigalionyte, Indra Yende-Zuma, Nonhlanhla Adams, Rochelle Dawood, Halima Dlamini, Linda Buthelezi, Sibonisile Chetty, Sheldon Diallo, Karidia Duffus, Wayne A. Mogashoa, Mary Hagen, Melissa B. Giandhari, Jennifer de Oliveira, Tulio Moodley, Pravi Padayatchi, Nesri Naidoo, Kogieleum |
author_facet | Chimukangara, Benjamin Lessells, Richard J. Singh, Lavanya Grigalionyte, Indra Yende-Zuma, Nonhlanhla Adams, Rochelle Dawood, Halima Dlamini, Linda Buthelezi, Sibonisile Chetty, Sheldon Diallo, Karidia Duffus, Wayne A. Mogashoa, Mary Hagen, Melissa B. Giandhari, Jennifer de Oliveira, Tulio Moodley, Pravi Padayatchi, Nesri Naidoo, Kogieleum |
author_sort | Chimukangara, Benjamin |
collection | PubMed |
description | BACKGROUND: Introduction of tenofovir (TDF) plus lamivudine (3TC) and dolutegravir (DTG) in first- and second-line HIV treatment regimens in South Africa warrants characterization of acquired HIV-1 drug resistance (ADR) mutations that could impact DTG-based antiretroviral therapy (ART). In this study, we sought to determine prevalence of ADR mutations and their potential impact on susceptibility to drugs used in combination with DTG among HIV-positive adults (≥ 18 years) accessing routine care at a selected ART facility in KwaZulu-Natal, South Africa. METHODS: We enrolled adult participants in a cross-sectional study between May and September 2019. Eligible participants had a most recent documented viral load (VL) ≥ 1000 copies/mL after at least 6 months on ART. We genotyped HIV-1 reverse transcriptase and protease genes by Sanger sequencing and assessed ADR. We characterized the effect of ADR mutations on the predicted susceptibility to drugs used in combination with DTG. RESULTS: From 143 participants enrolled, we obtained sequence data for 115 (80%), and 92.2% (95% CI 85.7–96.4) had ADR. The proportion with ADR was similar for participants on first-line ART (65/70, 92.9%, 95% CI 84.1–97.6) and those on second-line ART (40/44, 90.9%, 95% CI 78.3–97.5), and was present for the single participant on third-line ART. Approximately 89% (62/70) of those on first-line ART had dual class NRTI and NNRTI resistance and only six (13.6%) of those on second-line ART had major PI mutations. Most participants (82%) with first-line viraemia maintained susceptibility to Zidovudine (AZT), and the majority of them had lost susceptibility to TDF (71%) and 3TC (84%). Approximately two in every five TDF-treated individuals had thymidine analogue mutations (TAMs). CONCLUSIONS: Susceptibility to AZT among most participants with first-line viraemia suggests that a new second-line regimen of AZT + 3TC + DTG could be effective. However, atypical occurrence of TAMs in TDF-treated individuals suggests a less effective AZT + 3TC + DTG regimen in a subpopulation of patients. As most patients with first-line viraemia had at least low-level resistance to TDF and 3TC, identifying viraemia before switch to TDF + 3TC + DTG is important to avoid DTG functional monotherapy. These findings highlight a need for close monitoring of outcomes on new standardized treatment regimens. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12981-021-00393-5. |
format | Online Article Text |
id | pubmed-8520607 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-85206072021-10-20 Acquired HIV drug resistance and virologic monitoring in a HIV hyper-endemic setting in KwaZulu-Natal Province, South Africa Chimukangara, Benjamin Lessells, Richard J. Singh, Lavanya Grigalionyte, Indra Yende-Zuma, Nonhlanhla Adams, Rochelle Dawood, Halima Dlamini, Linda Buthelezi, Sibonisile Chetty, Sheldon Diallo, Karidia Duffus, Wayne A. Mogashoa, Mary Hagen, Melissa B. Giandhari, Jennifer de Oliveira, Tulio Moodley, Pravi Padayatchi, Nesri Naidoo, Kogieleum AIDS Res Ther Research BACKGROUND: Introduction of tenofovir (TDF) plus lamivudine (3TC) and dolutegravir (DTG) in first- and second-line HIV treatment regimens in South Africa warrants characterization of acquired HIV-1 drug resistance (ADR) mutations that could impact DTG-based antiretroviral therapy (ART). In this study, we sought to determine prevalence of ADR mutations and their potential impact on susceptibility to drugs used in combination with DTG among HIV-positive adults (≥ 18 years) accessing routine care at a selected ART facility in KwaZulu-Natal, South Africa. METHODS: We enrolled adult participants in a cross-sectional study between May and September 2019. Eligible participants had a most recent documented viral load (VL) ≥ 1000 copies/mL after at least 6 months on ART. We genotyped HIV-1 reverse transcriptase and protease genes by Sanger sequencing and assessed ADR. We characterized the effect of ADR mutations on the predicted susceptibility to drugs used in combination with DTG. RESULTS: From 143 participants enrolled, we obtained sequence data for 115 (80%), and 92.2% (95% CI 85.7–96.4) had ADR. The proportion with ADR was similar for participants on first-line ART (65/70, 92.9%, 95% CI 84.1–97.6) and those on second-line ART (40/44, 90.9%, 95% CI 78.3–97.5), and was present for the single participant on third-line ART. Approximately 89% (62/70) of those on first-line ART had dual class NRTI and NNRTI resistance and only six (13.6%) of those on second-line ART had major PI mutations. Most participants (82%) with first-line viraemia maintained susceptibility to Zidovudine (AZT), and the majority of them had lost susceptibility to TDF (71%) and 3TC (84%). Approximately two in every five TDF-treated individuals had thymidine analogue mutations (TAMs). CONCLUSIONS: Susceptibility to AZT among most participants with first-line viraemia suggests that a new second-line regimen of AZT + 3TC + DTG could be effective. However, atypical occurrence of TAMs in TDF-treated individuals suggests a less effective AZT + 3TC + DTG regimen in a subpopulation of patients. As most patients with first-line viraemia had at least low-level resistance to TDF and 3TC, identifying viraemia before switch to TDF + 3TC + DTG is important to avoid DTG functional monotherapy. These findings highlight a need for close monitoring of outcomes on new standardized treatment regimens. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12981-021-00393-5. BioMed Central 2021-10-16 /pmc/articles/PMC8520607/ /pubmed/34656129 http://dx.doi.org/10.1186/s12981-021-00393-5 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Chimukangara, Benjamin Lessells, Richard J. Singh, Lavanya Grigalionyte, Indra Yende-Zuma, Nonhlanhla Adams, Rochelle Dawood, Halima Dlamini, Linda Buthelezi, Sibonisile Chetty, Sheldon Diallo, Karidia Duffus, Wayne A. Mogashoa, Mary Hagen, Melissa B. Giandhari, Jennifer de Oliveira, Tulio Moodley, Pravi Padayatchi, Nesri Naidoo, Kogieleum Acquired HIV drug resistance and virologic monitoring in a HIV hyper-endemic setting in KwaZulu-Natal Province, South Africa |
title | Acquired HIV drug resistance and virologic monitoring in a HIV hyper-endemic setting in KwaZulu-Natal Province, South Africa |
title_full | Acquired HIV drug resistance and virologic monitoring in a HIV hyper-endemic setting in KwaZulu-Natal Province, South Africa |
title_fullStr | Acquired HIV drug resistance and virologic monitoring in a HIV hyper-endemic setting in KwaZulu-Natal Province, South Africa |
title_full_unstemmed | Acquired HIV drug resistance and virologic monitoring in a HIV hyper-endemic setting in KwaZulu-Natal Province, South Africa |
title_short | Acquired HIV drug resistance and virologic monitoring in a HIV hyper-endemic setting in KwaZulu-Natal Province, South Africa |
title_sort | acquired hiv drug resistance and virologic monitoring in a hiv hyper-endemic setting in kwazulu-natal province, south africa |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8520607/ https://www.ncbi.nlm.nih.gov/pubmed/34656129 http://dx.doi.org/10.1186/s12981-021-00393-5 |
work_keys_str_mv | AT chimukangarabenjamin acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT lessellsrichardj acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT singhlavanya acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT grigalionyteindra acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT yendezumanonhlanhla acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT adamsrochelle acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT dawoodhalima acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT dlaminilinda acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT buthelezisibonisile acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT chettysheldon acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT diallokaridia acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT duffuswaynea acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT mogashoamary acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT hagenmelissab acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT giandharijennifer acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT deoliveiratulio acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT moodleypravi acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT padayatchinesri acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica AT naidookogieleum acquiredhivdrugresistanceandvirologicmonitoringinahivhyperendemicsettinginkwazulunatalprovincesouthafrica |