Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification

When trialkylamines are added to buffered solutions of peptides, unexpected adducts can be formed. These adducts correspond to Schiff base products. The source of the reaction is the unexpected presence of aldehydes in amines. The aldehydes can be detected in a few ways. Most importantly, they can l...

Descripción completa

Detalles Bibliográficos
Autores principales: Ma, Yiran, Gandhi, Puja J., Reilly, James P.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Communication
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8587169/
https://www.ncbi.nlm.nih.gov/pubmed/34770892
http://dx.doi.org/10.3390/molecules26216481
_version_ 1784598083238100992
author Ma, Yiran
Gandhi, Puja J.
Reilly, James P.
author_facet Ma, Yiran
Gandhi, Puja J.
Reilly, James P.
author_sort Ma, Yiran
collection PubMed
description When trialkylamines are added to buffered solutions of peptides, unexpected adducts can be formed. These adducts correspond to Schiff base products. The source of the reaction is the unexpected presence of aldehydes in amines. The aldehydes can be detected in a few ways. Most importantly, they can lead to unanticipated results in proteomics experiments. Their undesirable effects can be minimized through the addition of other amines.
format Online
Article
Text
id pubmed-8587169
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-85871692021-11-13 Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification Ma, Yiran Gandhi, Puja J. Reilly, James P. Molecules Communication When trialkylamines are added to buffered solutions of peptides, unexpected adducts can be formed. These adducts correspond to Schiff base products. The source of the reaction is the unexpected presence of aldehydes in amines. The aldehydes can be detected in a few ways. Most importantly, they can lead to unanticipated results in proteomics experiments. Their undesirable effects can be minimized through the addition of other amines. MDPI 2021-10-27 /pmc/articles/PMC8587169/ /pubmed/34770892 http://dx.doi.org/10.3390/molecules26216481 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Communication
Ma, Yiran
Gandhi, Puja J.
Reilly, James P.
Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_full Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_fullStr Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_full_unstemmed Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_short Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_sort aqueous solutions of peptides and trialkylamines lead to unexpected peptide modification
topic Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8587169/
https://www.ncbi.nlm.nih.gov/pubmed/34770892
http://dx.doi.org/10.3390/molecules26216481
work_keys_str_mv AT mayiran aqueoussolutionsofpeptidesandtrialkylaminesleadtounexpectedpeptidemodification
AT gandhipujaj aqueoussolutionsofpeptidesandtrialkylaminesleadtounexpectedpeptidemodification
AT reillyjamesp aqueoussolutionsofpeptidesandtrialkylaminesleadtounexpectedpeptidemodification

Ejemplares similares