Cargando…

Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice

Neuroinflammation plays a key role in the pathogenesis of early brain injury (EBI) after subarachnoid hemorrhage (SAH). Previous studies have shown that metformin exerts anti-inflammatory effects and promotes functional recovery in various central nervous system diseases. We designed this study to i...

Descripción completa

Detalles Bibliográficos
Autores principales: Jin, Lei, Jin, Fa, Guo, Shenquan, Liu, Wenchao, Wei, Boyang, Fan, Haiyan, Li, Guangxu, Zhang, Xin, Su, Shixing, Li, Ran, Fang, Dazhao, Duan, Chuanzhi, Li, Xifeng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8969021/
https://www.ncbi.nlm.nih.gov/pubmed/35370693
http://dx.doi.org/10.3389/fphar.2022.796616
_version_ 1784679172049731584
author Jin, Lei
Jin, Fa
Guo, Shenquan
Liu, Wenchao
Wei, Boyang
Fan, Haiyan
Li, Guangxu
Zhang, Xin
Su, Shixing
Li, Ran
Fang, Dazhao
Duan, Chuanzhi
Li, Xifeng
author_facet Jin, Lei
Jin, Fa
Guo, Shenquan
Liu, Wenchao
Wei, Boyang
Fan, Haiyan
Li, Guangxu
Zhang, Xin
Su, Shixing
Li, Ran
Fang, Dazhao
Duan, Chuanzhi
Li, Xifeng
author_sort Jin, Lei
collection PubMed
description Neuroinflammation plays a key role in the pathogenesis of early brain injury (EBI) after subarachnoid hemorrhage (SAH). Previous studies have shown that metformin exerts anti-inflammatory effects and promotes functional recovery in various central nervous system diseases. We designed this study to investigate the effects of metformin on EBI after SAH. Our results indicate that the use of metformin alleviates the brain edema, behavioral disorders, cell apoptosis, and neuronal injury caused by SAH. The SAH-induced NLRP3-associated inflammatory response and the activation of microglia are also suppressed by metformin. However, we found that the blockade of AMPK with compound C weakened the neuroprotective effects of metformin on EBI. Collectively, our findings indicate that metformin exerts its neuroprotective effects by inhibiting neuroinflammation in an AMPK-dependent manner, by modulating the production of NLRP3-associated proinflammatory factors and the activation of microglia.
format Online
Article
Text
id pubmed-8969021
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-89690212022-04-01 Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice Jin, Lei Jin, Fa Guo, Shenquan Liu, Wenchao Wei, Boyang Fan, Haiyan Li, Guangxu Zhang, Xin Su, Shixing Li, Ran Fang, Dazhao Duan, Chuanzhi Li, Xifeng Front Pharmacol Pharmacology Neuroinflammation plays a key role in the pathogenesis of early brain injury (EBI) after subarachnoid hemorrhage (SAH). Previous studies have shown that metformin exerts anti-inflammatory effects and promotes functional recovery in various central nervous system diseases. We designed this study to investigate the effects of metformin on EBI after SAH. Our results indicate that the use of metformin alleviates the brain edema, behavioral disorders, cell apoptosis, and neuronal injury caused by SAH. The SAH-induced NLRP3-associated inflammatory response and the activation of microglia are also suppressed by metformin. However, we found that the blockade of AMPK with compound C weakened the neuroprotective effects of metformin on EBI. Collectively, our findings indicate that metformin exerts its neuroprotective effects by inhibiting neuroinflammation in an AMPK-dependent manner, by modulating the production of NLRP3-associated proinflammatory factors and the activation of microglia. Frontiers Media S.A. 2022-03-17 /pmc/articles/PMC8969021/ /pubmed/35370693 http://dx.doi.org/10.3389/fphar.2022.796616 Text en Copyright © 2022 Jin, Jin, Guo, Liu, Wei, Fan, Li, Zhang, Su, Li, Fang, Duan and Li. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Pharmacology
Jin, Lei
Jin, Fa
Guo, Shenquan
Liu, Wenchao
Wei, Boyang
Fan, Haiyan
Li, Guangxu
Zhang, Xin
Su, Shixing
Li, Ran
Fang, Dazhao
Duan, Chuanzhi
Li, Xifeng
Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice
title Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice
title_full Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice
title_fullStr Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice
title_full_unstemmed Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice
title_short Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice
title_sort metformin inhibits nlr family pyrin domain containing 3 (nlrp)-relevant neuroinflammation via an adenosine-5′-monophosphate-activated protein kinase (ampk)-dependent pathway to alleviate early brain injury after subarachnoid hemorrhage in mice
topic Pharmacology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8969021/
https://www.ncbi.nlm.nih.gov/pubmed/35370693
http://dx.doi.org/10.3389/fphar.2022.796616
work_keys_str_mv AT jinlei metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT jinfa metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT guoshenquan metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT liuwenchao metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT weiboyang metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT fanhaiyan metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT liguangxu metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT zhangxin metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT sushixing metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT liran metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT fangdazhao metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT duanchuanzhi metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice
AT lixifeng metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice