Cargando…
Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice
Neuroinflammation plays a key role in the pathogenesis of early brain injury (EBI) after subarachnoid hemorrhage (SAH). Previous studies have shown that metformin exerts anti-inflammatory effects and promotes functional recovery in various central nervous system diseases. We designed this study to i...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8969021/ https://www.ncbi.nlm.nih.gov/pubmed/35370693 http://dx.doi.org/10.3389/fphar.2022.796616 |
_version_ | 1784679172049731584 |
---|---|
author | Jin, Lei Jin, Fa Guo, Shenquan Liu, Wenchao Wei, Boyang Fan, Haiyan Li, Guangxu Zhang, Xin Su, Shixing Li, Ran Fang, Dazhao Duan, Chuanzhi Li, Xifeng |
author_facet | Jin, Lei Jin, Fa Guo, Shenquan Liu, Wenchao Wei, Boyang Fan, Haiyan Li, Guangxu Zhang, Xin Su, Shixing Li, Ran Fang, Dazhao Duan, Chuanzhi Li, Xifeng |
author_sort | Jin, Lei |
collection | PubMed |
description | Neuroinflammation plays a key role in the pathogenesis of early brain injury (EBI) after subarachnoid hemorrhage (SAH). Previous studies have shown that metformin exerts anti-inflammatory effects and promotes functional recovery in various central nervous system diseases. We designed this study to investigate the effects of metformin on EBI after SAH. Our results indicate that the use of metformin alleviates the brain edema, behavioral disorders, cell apoptosis, and neuronal injury caused by SAH. The SAH-induced NLRP3-associated inflammatory response and the activation of microglia are also suppressed by metformin. However, we found that the blockade of AMPK with compound C weakened the neuroprotective effects of metformin on EBI. Collectively, our findings indicate that metformin exerts its neuroprotective effects by inhibiting neuroinflammation in an AMPK-dependent manner, by modulating the production of NLRP3-associated proinflammatory factors and the activation of microglia. |
format | Online Article Text |
id | pubmed-8969021 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-89690212022-04-01 Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice Jin, Lei Jin, Fa Guo, Shenquan Liu, Wenchao Wei, Boyang Fan, Haiyan Li, Guangxu Zhang, Xin Su, Shixing Li, Ran Fang, Dazhao Duan, Chuanzhi Li, Xifeng Front Pharmacol Pharmacology Neuroinflammation plays a key role in the pathogenesis of early brain injury (EBI) after subarachnoid hemorrhage (SAH). Previous studies have shown that metformin exerts anti-inflammatory effects and promotes functional recovery in various central nervous system diseases. We designed this study to investigate the effects of metformin on EBI after SAH. Our results indicate that the use of metformin alleviates the brain edema, behavioral disorders, cell apoptosis, and neuronal injury caused by SAH. The SAH-induced NLRP3-associated inflammatory response and the activation of microglia are also suppressed by metformin. However, we found that the blockade of AMPK with compound C weakened the neuroprotective effects of metformin on EBI. Collectively, our findings indicate that metformin exerts its neuroprotective effects by inhibiting neuroinflammation in an AMPK-dependent manner, by modulating the production of NLRP3-associated proinflammatory factors and the activation of microglia. Frontiers Media S.A. 2022-03-17 /pmc/articles/PMC8969021/ /pubmed/35370693 http://dx.doi.org/10.3389/fphar.2022.796616 Text en Copyright © 2022 Jin, Jin, Guo, Liu, Wei, Fan, Li, Zhang, Su, Li, Fang, Duan and Li. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Pharmacology Jin, Lei Jin, Fa Guo, Shenquan Liu, Wenchao Wei, Boyang Fan, Haiyan Li, Guangxu Zhang, Xin Su, Shixing Li, Ran Fang, Dazhao Duan, Chuanzhi Li, Xifeng Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice |
title | Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice |
title_full | Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice |
title_fullStr | Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice |
title_full_unstemmed | Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice |
title_short | Metformin Inhibits NLR Family Pyrin Domain Containing 3 (NLRP)-Relevant Neuroinflammation via an Adenosine-5′-Monophosphate-Activated Protein Kinase (AMPK)-Dependent Pathway to Alleviate Early Brain Injury After Subarachnoid Hemorrhage in Mice |
title_sort | metformin inhibits nlr family pyrin domain containing 3 (nlrp)-relevant neuroinflammation via an adenosine-5′-monophosphate-activated protein kinase (ampk)-dependent pathway to alleviate early brain injury after subarachnoid hemorrhage in mice |
topic | Pharmacology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8969021/ https://www.ncbi.nlm.nih.gov/pubmed/35370693 http://dx.doi.org/10.3389/fphar.2022.796616 |
work_keys_str_mv | AT jinlei metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT jinfa metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT guoshenquan metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT liuwenchao metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT weiboyang metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT fanhaiyan metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT liguangxu metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT zhangxin metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT sushixing metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT liran metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT fangdazhao metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT duanchuanzhi metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice AT lixifeng metformininhibitsnlrfamilypyrindomaincontaining3nlrprelevantneuroinflammationviaanadenosine5monophosphateactivatedproteinkinaseampkdependentpathwaytoalleviateearlybraininjuryaftersubarachnoidhemorrhageinmice |