Cargando…
Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations
Background: The [(99m)Tc][Tc(N)(PNP)] system, where PNP is a bisphosphinoamine, is an interesting platform for the development of tumor ‘receptor-specific’ agents. Here, we compared the reactivity and impact of three [Tc(N)(PNP)] frameworks on the stability, receptor targeting properties, biodistrib...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9029856/ https://www.ncbi.nlm.nih.gov/pubmed/35458745 http://dx.doi.org/10.3390/molecules27082548 |
_version_ | 1784692002145697792 |
---|---|
author | Salvarese, Nicola Carpanese, Debora Meléndez-Alafort, Laura De Nardo, Laura Calderan, Andrea Biondi, Barbara Ruzza, Paolo Rosato, Antonio Bolzati, Cristina |
author_facet | Salvarese, Nicola Carpanese, Debora Meléndez-Alafort, Laura De Nardo, Laura Calderan, Andrea Biondi, Barbara Ruzza, Paolo Rosato, Antonio Bolzati, Cristina |
author_sort | Salvarese, Nicola |
collection | PubMed |
description | Background: The [(99m)Tc][Tc(N)(PNP)] system, where PNP is a bisphosphinoamine, is an interesting platform for the development of tumor ‘receptor-specific’ agents. Here, we compared the reactivity and impact of three [Tc(N)(PNP)] frameworks on the stability, receptor targeting properties, biodistribution, and metabolism of the corresponding [(99m)Tc][Tc(N)(PNP)]-tagged cRGDfK peptide to determine the best performing agent and to select the framework useful for the preparation of [(99m)Tc][Tc(N)(PNP)]-housing molecular targeting agents. Methods: cRGDfK pentapeptide was conjugated to Cys and labeled with each [Tc(N)(PNP)] framework. Radioconjugates were assessed for their lipophilicity, stability, in vitro and in vivo targeting properties, and performance. Results: All compounds were equally synthetically accessible and easy to purify (RCY ≥ 95%). The main influences of the synthon on the targeting peptide were observed in in vitro cell binding and in vivo. Conclusions: The variation in the substituents on the phosphorus atoms of the PNP enables a fine tuning of the biological features of the radioconjugates. ws[(99m)Tc][Tc(N)(PNP3OH)]– and [(99m)Tc][Tc(N)(PNP3)]– are better performing synthons in terms of labeling efficiency and in vivo performance than the [(99m)Tc][Tc(N)(PNP43)] framework and are therefore more suitable for further radiopharmaceutical purposes. Furthermore, the good labeling properties of the ws[(99m)Tc][Tc(N)(PNP3OH)]– framework can be exploited to extend this technology to the labeling of temperature-sensitive biomolecules suitable for SPECT imaging. |
format | Online Article Text |
id | pubmed-9029856 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-90298562022-04-23 Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations Salvarese, Nicola Carpanese, Debora Meléndez-Alafort, Laura De Nardo, Laura Calderan, Andrea Biondi, Barbara Ruzza, Paolo Rosato, Antonio Bolzati, Cristina Molecules Article Background: The [(99m)Tc][Tc(N)(PNP)] system, where PNP is a bisphosphinoamine, is an interesting platform for the development of tumor ‘receptor-specific’ agents. Here, we compared the reactivity and impact of three [Tc(N)(PNP)] frameworks on the stability, receptor targeting properties, biodistribution, and metabolism of the corresponding [(99m)Tc][Tc(N)(PNP)]-tagged cRGDfK peptide to determine the best performing agent and to select the framework useful for the preparation of [(99m)Tc][Tc(N)(PNP)]-housing molecular targeting agents. Methods: cRGDfK pentapeptide was conjugated to Cys and labeled with each [Tc(N)(PNP)] framework. Radioconjugates were assessed for their lipophilicity, stability, in vitro and in vivo targeting properties, and performance. Results: All compounds were equally synthetically accessible and easy to purify (RCY ≥ 95%). The main influences of the synthon on the targeting peptide were observed in in vitro cell binding and in vivo. Conclusions: The variation in the substituents on the phosphorus atoms of the PNP enables a fine tuning of the biological features of the radioconjugates. ws[(99m)Tc][Tc(N)(PNP3OH)]– and [(99m)Tc][Tc(N)(PNP3)]– are better performing synthons in terms of labeling efficiency and in vivo performance than the [(99m)Tc][Tc(N)(PNP43)] framework and are therefore more suitable for further radiopharmaceutical purposes. Furthermore, the good labeling properties of the ws[(99m)Tc][Tc(N)(PNP3OH)]– framework can be exploited to extend this technology to the labeling of temperature-sensitive biomolecules suitable for SPECT imaging. MDPI 2022-04-14 /pmc/articles/PMC9029856/ /pubmed/35458745 http://dx.doi.org/10.3390/molecules27082548 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Salvarese, Nicola Carpanese, Debora Meléndez-Alafort, Laura De Nardo, Laura Calderan, Andrea Biondi, Barbara Ruzza, Paolo Rosato, Antonio Bolzati, Cristina Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations |
title | Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations |
title_full | Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations |
title_fullStr | Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations |
title_full_unstemmed | Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations |
title_short | Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations |
title_sort | impact of different [tc(n)pnp]-scaffolds on the biological properties of the small crgdfk peptide: synthesis, in vitro and in vivo evaluations |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9029856/ https://www.ncbi.nlm.nih.gov/pubmed/35458745 http://dx.doi.org/10.3390/molecules27082548 |
work_keys_str_mv | AT salvaresenicola impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations AT carpanesedebora impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations AT melendezalafortlaura impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations AT denardolaura impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations AT calderanandrea impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations AT biondibarbara impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations AT ruzzapaolo impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations AT rosatoantonio impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations AT bolzaticristina impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations |