Cargando…

Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations

Background: The [(99m)Tc][Tc(N)(PNP)] system, where PNP is a bisphosphinoamine, is an interesting platform for the development of tumor ‘receptor-specific’ agents. Here, we compared the reactivity and impact of three [Tc(N)(PNP)] frameworks on the stability, receptor targeting properties, biodistrib...

Descripción completa

Detalles Bibliográficos
Autores principales: Salvarese, Nicola, Carpanese, Debora, Meléndez-Alafort, Laura, De Nardo, Laura, Calderan, Andrea, Biondi, Barbara, Ruzza, Paolo, Rosato, Antonio, Bolzati, Cristina
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9029856/
https://www.ncbi.nlm.nih.gov/pubmed/35458745
http://dx.doi.org/10.3390/molecules27082548
_version_ 1784692002145697792
author Salvarese, Nicola
Carpanese, Debora
Meléndez-Alafort, Laura
De Nardo, Laura
Calderan, Andrea
Biondi, Barbara
Ruzza, Paolo
Rosato, Antonio
Bolzati, Cristina
author_facet Salvarese, Nicola
Carpanese, Debora
Meléndez-Alafort, Laura
De Nardo, Laura
Calderan, Andrea
Biondi, Barbara
Ruzza, Paolo
Rosato, Antonio
Bolzati, Cristina
author_sort Salvarese, Nicola
collection PubMed
description Background: The [(99m)Tc][Tc(N)(PNP)] system, where PNP is a bisphosphinoamine, is an interesting platform for the development of tumor ‘receptor-specific’ agents. Here, we compared the reactivity and impact of three [Tc(N)(PNP)] frameworks on the stability, receptor targeting properties, biodistribution, and metabolism of the corresponding [(99m)Tc][Tc(N)(PNP)]-tagged cRGDfK peptide to determine the best performing agent and to select the framework useful for the preparation of [(99m)Tc][Tc(N)(PNP)]-housing molecular targeting agents. Methods: cRGDfK pentapeptide was conjugated to Cys and labeled with each [Tc(N)(PNP)] framework. Radioconjugates were assessed for their lipophilicity, stability, in vitro and in vivo targeting properties, and performance. Results: All compounds were equally synthetically accessible and easy to purify (RCY ≥ 95%). The main influences of the synthon on the targeting peptide were observed in in vitro cell binding and in vivo. Conclusions: The variation in the substituents on the phosphorus atoms of the PNP enables a fine tuning of the biological features of the radioconjugates. ws[(99m)Tc][Tc(N)(PNP3OH)]– and [(99m)Tc][Tc(N)(PNP3)]– are better performing synthons in terms of labeling efficiency and in vivo performance than the [(99m)Tc][Tc(N)(PNP43)] framework and are therefore more suitable for further radiopharmaceutical purposes. Furthermore, the good labeling properties of the ws[(99m)Tc][Tc(N)(PNP3OH)]– framework can be exploited to extend this technology to the labeling of temperature-sensitive biomolecules suitable for SPECT imaging.
format Online
Article
Text
id pubmed-9029856
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-90298562022-04-23 Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations Salvarese, Nicola Carpanese, Debora Meléndez-Alafort, Laura De Nardo, Laura Calderan, Andrea Biondi, Barbara Ruzza, Paolo Rosato, Antonio Bolzati, Cristina Molecules Article Background: The [(99m)Tc][Tc(N)(PNP)] system, where PNP is a bisphosphinoamine, is an interesting platform for the development of tumor ‘receptor-specific’ agents. Here, we compared the reactivity and impact of three [Tc(N)(PNP)] frameworks on the stability, receptor targeting properties, biodistribution, and metabolism of the corresponding [(99m)Tc][Tc(N)(PNP)]-tagged cRGDfK peptide to determine the best performing agent and to select the framework useful for the preparation of [(99m)Tc][Tc(N)(PNP)]-housing molecular targeting agents. Methods: cRGDfK pentapeptide was conjugated to Cys and labeled with each [Tc(N)(PNP)] framework. Radioconjugates were assessed for their lipophilicity, stability, in vitro and in vivo targeting properties, and performance. Results: All compounds were equally synthetically accessible and easy to purify (RCY ≥ 95%). The main influences of the synthon on the targeting peptide were observed in in vitro cell binding and in vivo. Conclusions: The variation in the substituents on the phosphorus atoms of the PNP enables a fine tuning of the biological features of the radioconjugates. ws[(99m)Tc][Tc(N)(PNP3OH)]– and [(99m)Tc][Tc(N)(PNP3)]– are better performing synthons in terms of labeling efficiency and in vivo performance than the [(99m)Tc][Tc(N)(PNP43)] framework and are therefore more suitable for further radiopharmaceutical purposes. Furthermore, the good labeling properties of the ws[(99m)Tc][Tc(N)(PNP3OH)]– framework can be exploited to extend this technology to the labeling of temperature-sensitive biomolecules suitable for SPECT imaging. MDPI 2022-04-14 /pmc/articles/PMC9029856/ /pubmed/35458745 http://dx.doi.org/10.3390/molecules27082548 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Salvarese, Nicola
Carpanese, Debora
Meléndez-Alafort, Laura
De Nardo, Laura
Calderan, Andrea
Biondi, Barbara
Ruzza, Paolo
Rosato, Antonio
Bolzati, Cristina
Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations
title Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations
title_full Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations
title_fullStr Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations
title_full_unstemmed Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations
title_short Impact of Different [Tc(N)PNP]-Scaffolds on the Biological Properties of the Small cRGDfK Peptide: Synthesis, In Vitro and In Vivo Evaluations
title_sort impact of different [tc(n)pnp]-scaffolds on the biological properties of the small crgdfk peptide: synthesis, in vitro and in vivo evaluations
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9029856/
https://www.ncbi.nlm.nih.gov/pubmed/35458745
http://dx.doi.org/10.3390/molecules27082548
work_keys_str_mv AT salvaresenicola impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations
AT carpanesedebora impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations
AT melendezalafortlaura impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations
AT denardolaura impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations
AT calderanandrea impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations
AT biondibarbara impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations
AT ruzzapaolo impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations
AT rosatoantonio impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations
AT bolzaticristina impactofdifferenttcnpnpscaffoldsonthebiologicalpropertiesofthesmallcrgdfkpeptidesynthesisinvitroandinvivoevaluations