Cargando…
Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails
Identification of highly selective type II kinase inhibitors is described. Two different chiral peptidomimetic scaffolds were introduced on the tail region of non-selective type II kinase inhibitor GNF-7 to enhance the selectivity. Kinome-wide selectivity profiling analysis showed that type II kinas...
Autores principales: | , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9067983/ https://www.ncbi.nlm.nih.gov/pubmed/35484863 http://dx.doi.org/10.1080/14756366.2022.2068148 |
_version_ | 1784700131655811072 |
---|---|
author | Han, Seo-Jung Jung, Jae Eun Oh, Do Hee Kim, Minsup Kim, Jae-Min Chung, Kyung-Sook Han, Hee-Soo Lee, Jeong-Hun Lee, Kyung-Tae Jeong, Hee Jin Park, In Ho Jeon, Eunkyeong Shin, Jeon-Soo Hwang, Dongkeun Cho, Art E. Lee, Duck-Hyung Sim, Taebo |
author_facet | Han, Seo-Jung Jung, Jae Eun Oh, Do Hee Kim, Minsup Kim, Jae-Min Chung, Kyung-Sook Han, Hee-Soo Lee, Jeong-Hun Lee, Kyung-Tae Jeong, Hee Jin Park, In Ho Jeon, Eunkyeong Shin, Jeon-Soo Hwang, Dongkeun Cho, Art E. Lee, Duck-Hyung Sim, Taebo |
author_sort | Han, Seo-Jung |
collection | PubMed |
description | Identification of highly selective type II kinase inhibitors is described. Two different chiral peptidomimetic scaffolds were introduced on the tail region of non-selective type II kinase inhibitor GNF-7 to enhance the selectivity. Kinome-wide selectivity profiling analysis showed that type II kinase inhibitor 7a potently inhibited Lck kinase with great selectivity (IC(50) of 23.0 nM). It was found that 7a and its derivatives possessed high selectivity for Lck over even structurally conserved all Src family kinases. We also observed that 7a inhibited Lck activation in Jurkat T cells. Moreover, 7a was found to alleviate clinical symptoms in DSS-induced colitis mice. This study provides a novel insight into the design of selective type II kinase inhibitors by adopting chiral peptidomimetic moieties on the tail region. |
format | Online Article Text |
id | pubmed-9067983 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-90679832022-05-05 Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails Han, Seo-Jung Jung, Jae Eun Oh, Do Hee Kim, Minsup Kim, Jae-Min Chung, Kyung-Sook Han, Hee-Soo Lee, Jeong-Hun Lee, Kyung-Tae Jeong, Hee Jin Park, In Ho Jeon, Eunkyeong Shin, Jeon-Soo Hwang, Dongkeun Cho, Art E. Lee, Duck-Hyung Sim, Taebo J Enzyme Inhib Med Chem Research Paper Identification of highly selective type II kinase inhibitors is described. Two different chiral peptidomimetic scaffolds were introduced on the tail region of non-selective type II kinase inhibitor GNF-7 to enhance the selectivity. Kinome-wide selectivity profiling analysis showed that type II kinase inhibitor 7a potently inhibited Lck kinase with great selectivity (IC(50) of 23.0 nM). It was found that 7a and its derivatives possessed high selectivity for Lck over even structurally conserved all Src family kinases. We also observed that 7a inhibited Lck activation in Jurkat T cells. Moreover, 7a was found to alleviate clinical symptoms in DSS-induced colitis mice. This study provides a novel insight into the design of selective type II kinase inhibitors by adopting chiral peptidomimetic moieties on the tail region. Taylor & Francis 2022-04-28 /pmc/articles/PMC9067983/ /pubmed/35484863 http://dx.doi.org/10.1080/14756366.2022.2068148 Text en © 2022 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Paper Han, Seo-Jung Jung, Jae Eun Oh, Do Hee Kim, Minsup Kim, Jae-Min Chung, Kyung-Sook Han, Hee-Soo Lee, Jeong-Hun Lee, Kyung-Tae Jeong, Hee Jin Park, In Ho Jeon, Eunkyeong Shin, Jeon-Soo Hwang, Dongkeun Cho, Art E. Lee, Duck-Hyung Sim, Taebo Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails |
title | Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails |
title_full | Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails |
title_fullStr | Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails |
title_full_unstemmed | Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails |
title_short | Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails |
title_sort | identification of highly selective type ii kinase inhibitors with chiral peptidomimetic tails |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9067983/ https://www.ncbi.nlm.nih.gov/pubmed/35484863 http://dx.doi.org/10.1080/14756366.2022.2068148 |
work_keys_str_mv | AT hanseojung identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT jungjaeeun identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT ohdohee identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT kimminsup identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT kimjaemin identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT chungkyungsook identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT hanheesoo identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT leejeonghun identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT leekyungtae identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT jeongheejin identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT parkinho identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT jeoneunkyeong identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT shinjeonsoo identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT hwangdongkeun identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT choarte identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT leeduckhyung identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails AT simtaebo identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails |