Cargando…

Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails

Identification of highly selective type II kinase inhibitors is described. Two different chiral peptidomimetic scaffolds were introduced on the tail region of non-selective type II kinase inhibitor GNF-7 to enhance the selectivity. Kinome-wide selectivity profiling analysis showed that type II kinas...

Descripción completa

Detalles Bibliográficos
Autores principales: Han, Seo-Jung, Jung, Jae Eun, Oh, Do Hee, Kim, Minsup, Kim, Jae-Min, Chung, Kyung-Sook, Han, Hee-Soo, Lee, Jeong-Hun, Lee, Kyung-Tae, Jeong, Hee Jin, Park, In Ho, Jeon, Eunkyeong, Shin, Jeon-Soo, Hwang, Dongkeun, Cho, Art E., Lee, Duck-Hyung, Sim, Taebo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9067983/
https://www.ncbi.nlm.nih.gov/pubmed/35484863
http://dx.doi.org/10.1080/14756366.2022.2068148
_version_ 1784700131655811072
author Han, Seo-Jung
Jung, Jae Eun
Oh, Do Hee
Kim, Minsup
Kim, Jae-Min
Chung, Kyung-Sook
Han, Hee-Soo
Lee, Jeong-Hun
Lee, Kyung-Tae
Jeong, Hee Jin
Park, In Ho
Jeon, Eunkyeong
Shin, Jeon-Soo
Hwang, Dongkeun
Cho, Art E.
Lee, Duck-Hyung
Sim, Taebo
author_facet Han, Seo-Jung
Jung, Jae Eun
Oh, Do Hee
Kim, Minsup
Kim, Jae-Min
Chung, Kyung-Sook
Han, Hee-Soo
Lee, Jeong-Hun
Lee, Kyung-Tae
Jeong, Hee Jin
Park, In Ho
Jeon, Eunkyeong
Shin, Jeon-Soo
Hwang, Dongkeun
Cho, Art E.
Lee, Duck-Hyung
Sim, Taebo
author_sort Han, Seo-Jung
collection PubMed
description Identification of highly selective type II kinase inhibitors is described. Two different chiral peptidomimetic scaffolds were introduced on the tail region of non-selective type II kinase inhibitor GNF-7 to enhance the selectivity. Kinome-wide selectivity profiling analysis showed that type II kinase inhibitor 7a potently inhibited Lck kinase with great selectivity (IC(50) of 23.0 nM). It was found that 7a and its derivatives possessed high selectivity for Lck over even structurally conserved all Src family kinases. We also observed that 7a inhibited Lck activation in Jurkat T cells. Moreover, 7a was found to alleviate clinical symptoms in DSS-induced colitis mice. This study provides a novel insight into the design of selective type II kinase inhibitors by adopting chiral peptidomimetic moieties on the tail region.
format Online
Article
Text
id pubmed-9067983
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-90679832022-05-05 Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails Han, Seo-Jung Jung, Jae Eun Oh, Do Hee Kim, Minsup Kim, Jae-Min Chung, Kyung-Sook Han, Hee-Soo Lee, Jeong-Hun Lee, Kyung-Tae Jeong, Hee Jin Park, In Ho Jeon, Eunkyeong Shin, Jeon-Soo Hwang, Dongkeun Cho, Art E. Lee, Duck-Hyung Sim, Taebo J Enzyme Inhib Med Chem Research Paper Identification of highly selective type II kinase inhibitors is described. Two different chiral peptidomimetic scaffolds were introduced on the tail region of non-selective type II kinase inhibitor GNF-7 to enhance the selectivity. Kinome-wide selectivity profiling analysis showed that type II kinase inhibitor 7a potently inhibited Lck kinase with great selectivity (IC(50) of 23.0 nM). It was found that 7a and its derivatives possessed high selectivity for Lck over even structurally conserved all Src family kinases. We also observed that 7a inhibited Lck activation in Jurkat T cells. Moreover, 7a was found to alleviate clinical symptoms in DSS-induced colitis mice. This study provides a novel insight into the design of selective type II kinase inhibitors by adopting chiral peptidomimetic moieties on the tail region. Taylor & Francis 2022-04-28 /pmc/articles/PMC9067983/ /pubmed/35484863 http://dx.doi.org/10.1080/14756366.2022.2068148 Text en © 2022 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Paper
Han, Seo-Jung
Jung, Jae Eun
Oh, Do Hee
Kim, Minsup
Kim, Jae-Min
Chung, Kyung-Sook
Han, Hee-Soo
Lee, Jeong-Hun
Lee, Kyung-Tae
Jeong, Hee Jin
Park, In Ho
Jeon, Eunkyeong
Shin, Jeon-Soo
Hwang, Dongkeun
Cho, Art E.
Lee, Duck-Hyung
Sim, Taebo
Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails
title Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails
title_full Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails
title_fullStr Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails
title_full_unstemmed Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails
title_short Identification of highly selective type II kinase inhibitors with chiral peptidomimetic tails
title_sort identification of highly selective type ii kinase inhibitors with chiral peptidomimetic tails
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9067983/
https://www.ncbi.nlm.nih.gov/pubmed/35484863
http://dx.doi.org/10.1080/14756366.2022.2068148
work_keys_str_mv AT hanseojung identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT jungjaeeun identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT ohdohee identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT kimminsup identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT kimjaemin identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT chungkyungsook identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT hanheesoo identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT leejeonghun identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT leekyungtae identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT jeongheejin identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT parkinho identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT jeoneunkyeong identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT shinjeonsoo identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT hwangdongkeun identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT choarte identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT leeduckhyung identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails
AT simtaebo identificationofhighlyselectivetypeiikinaseinhibitorswithchiralpeptidomimetictails