Cargando…

High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map

BACKGROUND: Yield-related traits including thousand grain weight (TGW), grain number per spike (GNS), grain width (GW), grain length (GL), plant height (PH), spike length (SL), and spikelet number per spike (SNS) are greatly associated with grain yield of wheat (Triticum aestivum L.). To detect quan...

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Tao, Li, Qiao, Wang, Jinhui, Yang, Zhao, Tang, Yanyan, Su, Yan, Zhang, Juanyu, Qiu, Xvebing, Pu, Xi, Pan, Zhifen, Zhang, Haili, Liang, Junjun, Liu, Zehou, Li, Jun, Yan, Wuyun, Yu, Maoqun, Long, Hai, Wei, Yuming, Deng, Guangbing
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9107147/
https://www.ncbi.nlm.nih.gov/pubmed/35562674
http://dx.doi.org/10.1186/s12863-022-01050-0
_version_ 1784708428173672448
author Li, Tao
Li, Qiao
Wang, Jinhui
Yang, Zhao
Tang, Yanyan
Su, Yan
Zhang, Juanyu
Qiu, Xvebing
Pu, Xi
Pan, Zhifen
Zhang, Haili
Liang, Junjun
Liu, Zehou
Li, Jun
Yan, Wuyun
Yu, Maoqun
Long, Hai
Wei, Yuming
Deng, Guangbing
author_facet Li, Tao
Li, Qiao
Wang, Jinhui
Yang, Zhao
Tang, Yanyan
Su, Yan
Zhang, Juanyu
Qiu, Xvebing
Pu, Xi
Pan, Zhifen
Zhang, Haili
Liang, Junjun
Liu, Zehou
Li, Jun
Yan, Wuyun
Yu, Maoqun
Long, Hai
Wei, Yuming
Deng, Guangbing
author_sort Li, Tao
collection PubMed
description BACKGROUND: Yield-related traits including thousand grain weight (TGW), grain number per spike (GNS), grain width (GW), grain length (GL), plant height (PH), spike length (SL), and spikelet number per spike (SNS) are greatly associated with grain yield of wheat (Triticum aestivum L.). To detect quantitative trait loci (QTL) associated with them, 193 recombinant inbred lines derived from two elite winter wheat varieties Chuanmai42 and Chuanmai39 were employed to perform QTL mapping in six/eight environments. RESULTS: A total of 30 QTLs on chromosomes 1A, 1B, 1D, 2A, 2B, 2D, 3A, 4A, 5A, 5B, 6A, 6D, 7A, 7B and 7D were identified. Among them, six major QTLs QTgw.cib-6A.1, QTgw.cib-6A.2, QGw.cib-6A, QGl.cib-3A, QGl.cib-6A, and QSl.cib-2D explaining 5.96-23.75% of the phenotypic variance were detected in multi-environments and showed strong and stable effects on corresponding traits. Three QTL clusters on chromosomes 2D and 6A containing 10 QTLs were also detected, which showed significant pleiotropic effects on multiple traits. Additionally, three Kompetitive Allele Specific PCR (KASP) markers linked with five of these major QTLs were developed. Candidate genes of QTgw.cib-6A.1/QGl.cib-6A and QGl.cib-3A were analyzed based on the spatiotemporal expression patterns, gene annotation, and orthologous search. CONCLUSIONS: Six major QTLs for TGW, GL, GW and SL were detected. Three KASP markers linked with five of these major QTLs were developed. These QTLs and KASP markers will be useful for elucidating the genetic architecture of grain yield and developing new wheat varieties with high and stable yield in wheat. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12863-022-01050-0.
format Online
Article
Text
id pubmed-9107147
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-91071472022-05-15 High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map Li, Tao Li, Qiao Wang, Jinhui Yang, Zhao Tang, Yanyan Su, Yan Zhang, Juanyu Qiu, Xvebing Pu, Xi Pan, Zhifen Zhang, Haili Liang, Junjun Liu, Zehou Li, Jun Yan, Wuyun Yu, Maoqun Long, Hai Wei, Yuming Deng, Guangbing BMC Genom Data Research BACKGROUND: Yield-related traits including thousand grain weight (TGW), grain number per spike (GNS), grain width (GW), grain length (GL), plant height (PH), spike length (SL), and spikelet number per spike (SNS) are greatly associated with grain yield of wheat (Triticum aestivum L.). To detect quantitative trait loci (QTL) associated with them, 193 recombinant inbred lines derived from two elite winter wheat varieties Chuanmai42 and Chuanmai39 were employed to perform QTL mapping in six/eight environments. RESULTS: A total of 30 QTLs on chromosomes 1A, 1B, 1D, 2A, 2B, 2D, 3A, 4A, 5A, 5B, 6A, 6D, 7A, 7B and 7D were identified. Among them, six major QTLs QTgw.cib-6A.1, QTgw.cib-6A.2, QGw.cib-6A, QGl.cib-3A, QGl.cib-6A, and QSl.cib-2D explaining 5.96-23.75% of the phenotypic variance were detected in multi-environments and showed strong and stable effects on corresponding traits. Three QTL clusters on chromosomes 2D and 6A containing 10 QTLs were also detected, which showed significant pleiotropic effects on multiple traits. Additionally, three Kompetitive Allele Specific PCR (KASP) markers linked with five of these major QTLs were developed. Candidate genes of QTgw.cib-6A.1/QGl.cib-6A and QGl.cib-3A were analyzed based on the spatiotemporal expression patterns, gene annotation, and orthologous search. CONCLUSIONS: Six major QTLs for TGW, GL, GW and SL were detected. Three KASP markers linked with five of these major QTLs were developed. These QTLs and KASP markers will be useful for elucidating the genetic architecture of grain yield and developing new wheat varieties with high and stable yield in wheat. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12863-022-01050-0. BioMed Central 2022-05-13 /pmc/articles/PMC9107147/ /pubmed/35562674 http://dx.doi.org/10.1186/s12863-022-01050-0 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visithttp://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Li, Tao
Li, Qiao
Wang, Jinhui
Yang, Zhao
Tang, Yanyan
Su, Yan
Zhang, Juanyu
Qiu, Xvebing
Pu, Xi
Pan, Zhifen
Zhang, Haili
Liang, Junjun
Liu, Zehou
Li, Jun
Yan, Wuyun
Yu, Maoqun
Long, Hai
Wei, Yuming
Deng, Guangbing
High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map
title High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map
title_full High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map
title_fullStr High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map
title_full_unstemmed High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map
title_short High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map
title_sort high-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (triticum aestivum l.) using a high-density slaf-seq genetic map
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9107147/
https://www.ncbi.nlm.nih.gov/pubmed/35562674
http://dx.doi.org/10.1186/s12863-022-01050-0
work_keys_str_mv AT litao highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT liqiao highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT wangjinhui highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT yangzhao highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT tangyanyan highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT suyan highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT zhangjuanyu highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT qiuxvebing highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT puxi highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT panzhifen highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT zhanghaili highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT liangjunjun highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT liuzehou highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT lijun highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT yanwuyun highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT yumaoqun highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT longhai highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT weiyuming highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap
AT dengguangbing highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap