Cargando…
High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map
BACKGROUND: Yield-related traits including thousand grain weight (TGW), grain number per spike (GNS), grain width (GW), grain length (GL), plant height (PH), spike length (SL), and spikelet number per spike (SNS) are greatly associated with grain yield of wheat (Triticum aestivum L.). To detect quan...
Autores principales: | , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9107147/ https://www.ncbi.nlm.nih.gov/pubmed/35562674 http://dx.doi.org/10.1186/s12863-022-01050-0 |
_version_ | 1784708428173672448 |
---|---|
author | Li, Tao Li, Qiao Wang, Jinhui Yang, Zhao Tang, Yanyan Su, Yan Zhang, Juanyu Qiu, Xvebing Pu, Xi Pan, Zhifen Zhang, Haili Liang, Junjun Liu, Zehou Li, Jun Yan, Wuyun Yu, Maoqun Long, Hai Wei, Yuming Deng, Guangbing |
author_facet | Li, Tao Li, Qiao Wang, Jinhui Yang, Zhao Tang, Yanyan Su, Yan Zhang, Juanyu Qiu, Xvebing Pu, Xi Pan, Zhifen Zhang, Haili Liang, Junjun Liu, Zehou Li, Jun Yan, Wuyun Yu, Maoqun Long, Hai Wei, Yuming Deng, Guangbing |
author_sort | Li, Tao |
collection | PubMed |
description | BACKGROUND: Yield-related traits including thousand grain weight (TGW), grain number per spike (GNS), grain width (GW), grain length (GL), plant height (PH), spike length (SL), and spikelet number per spike (SNS) are greatly associated with grain yield of wheat (Triticum aestivum L.). To detect quantitative trait loci (QTL) associated with them, 193 recombinant inbred lines derived from two elite winter wheat varieties Chuanmai42 and Chuanmai39 were employed to perform QTL mapping in six/eight environments. RESULTS: A total of 30 QTLs on chromosomes 1A, 1B, 1D, 2A, 2B, 2D, 3A, 4A, 5A, 5B, 6A, 6D, 7A, 7B and 7D were identified. Among them, six major QTLs QTgw.cib-6A.1, QTgw.cib-6A.2, QGw.cib-6A, QGl.cib-3A, QGl.cib-6A, and QSl.cib-2D explaining 5.96-23.75% of the phenotypic variance were detected in multi-environments and showed strong and stable effects on corresponding traits. Three QTL clusters on chromosomes 2D and 6A containing 10 QTLs were also detected, which showed significant pleiotropic effects on multiple traits. Additionally, three Kompetitive Allele Specific PCR (KASP) markers linked with five of these major QTLs were developed. Candidate genes of QTgw.cib-6A.1/QGl.cib-6A and QGl.cib-3A were analyzed based on the spatiotemporal expression patterns, gene annotation, and orthologous search. CONCLUSIONS: Six major QTLs for TGW, GL, GW and SL were detected. Three KASP markers linked with five of these major QTLs were developed. These QTLs and KASP markers will be useful for elucidating the genetic architecture of grain yield and developing new wheat varieties with high and stable yield in wheat. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12863-022-01050-0. |
format | Online Article Text |
id | pubmed-9107147 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-91071472022-05-15 High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map Li, Tao Li, Qiao Wang, Jinhui Yang, Zhao Tang, Yanyan Su, Yan Zhang, Juanyu Qiu, Xvebing Pu, Xi Pan, Zhifen Zhang, Haili Liang, Junjun Liu, Zehou Li, Jun Yan, Wuyun Yu, Maoqun Long, Hai Wei, Yuming Deng, Guangbing BMC Genom Data Research BACKGROUND: Yield-related traits including thousand grain weight (TGW), grain number per spike (GNS), grain width (GW), grain length (GL), plant height (PH), spike length (SL), and spikelet number per spike (SNS) are greatly associated with grain yield of wheat (Triticum aestivum L.). To detect quantitative trait loci (QTL) associated with them, 193 recombinant inbred lines derived from two elite winter wheat varieties Chuanmai42 and Chuanmai39 were employed to perform QTL mapping in six/eight environments. RESULTS: A total of 30 QTLs on chromosomes 1A, 1B, 1D, 2A, 2B, 2D, 3A, 4A, 5A, 5B, 6A, 6D, 7A, 7B and 7D were identified. Among them, six major QTLs QTgw.cib-6A.1, QTgw.cib-6A.2, QGw.cib-6A, QGl.cib-3A, QGl.cib-6A, and QSl.cib-2D explaining 5.96-23.75% of the phenotypic variance were detected in multi-environments and showed strong and stable effects on corresponding traits. Three QTL clusters on chromosomes 2D and 6A containing 10 QTLs were also detected, which showed significant pleiotropic effects on multiple traits. Additionally, three Kompetitive Allele Specific PCR (KASP) markers linked with five of these major QTLs were developed. Candidate genes of QTgw.cib-6A.1/QGl.cib-6A and QGl.cib-3A were analyzed based on the spatiotemporal expression patterns, gene annotation, and orthologous search. CONCLUSIONS: Six major QTLs for TGW, GL, GW and SL were detected. Three KASP markers linked with five of these major QTLs were developed. These QTLs and KASP markers will be useful for elucidating the genetic architecture of grain yield and developing new wheat varieties with high and stable yield in wheat. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12863-022-01050-0. BioMed Central 2022-05-13 /pmc/articles/PMC9107147/ /pubmed/35562674 http://dx.doi.org/10.1186/s12863-022-01050-0 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visithttp://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Li, Tao Li, Qiao Wang, Jinhui Yang, Zhao Tang, Yanyan Su, Yan Zhang, Juanyu Qiu, Xvebing Pu, Xi Pan, Zhifen Zhang, Haili Liang, Junjun Liu, Zehou Li, Jun Yan, Wuyun Yu, Maoqun Long, Hai Wei, Yuming Deng, Guangbing High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map |
title | High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map |
title_full | High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map |
title_fullStr | High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map |
title_full_unstemmed | High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map |
title_short | High-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (Triticum aestivum L.) using a high-density SLAF-seq genetic map |
title_sort | high-resolution detection of quantitative trait loci for seven important yield-related traits in wheat (triticum aestivum l.) using a high-density slaf-seq genetic map |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9107147/ https://www.ncbi.nlm.nih.gov/pubmed/35562674 http://dx.doi.org/10.1186/s12863-022-01050-0 |
work_keys_str_mv | AT litao highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT liqiao highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT wangjinhui highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT yangzhao highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT tangyanyan highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT suyan highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT zhangjuanyu highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT qiuxvebing highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT puxi highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT panzhifen highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT zhanghaili highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT liangjunjun highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT liuzehou highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT lijun highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT yanwuyun highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT yumaoqun highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT longhai highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT weiyuming highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap AT dengguangbing highresolutiondetectionofquantitativetraitlociforsevenimportantyieldrelatedtraitsinwheattriticumaestivumlusingahighdensityslafseqgeneticmap |