Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site

Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide...

Descripción completa

Detalles Bibliográficos
Autores principales: Fan, Lu, Warnecke, Athanasia, Weder, Julia, Preller, Matthias, Zeilinger, Carsten
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Communication
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9266618/
https://www.ncbi.nlm.nih.gov/pubmed/35806154
http://dx.doi.org/10.3390/ijms23137150
_version_ 1784743512218009600
author Fan, Lu
Warnecke, Athanasia
Weder, Julia
Preller, Matthias
Zeilinger, Carsten
author_facet Fan, Lu
Warnecke, Athanasia
Weder, Julia
Preller, Matthias
Zeilinger, Carsten
author_sort Fan, Lu
collection PubMed
description Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC(50) of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
format Online
Article
Text
id pubmed-9266618
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-92666182022-07-09 Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site Fan, Lu Warnecke, Athanasia Weder, Julia Preller, Matthias Zeilinger, Carsten Int J Mol Sci Communication Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC(50) of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP. MDPI 2022-06-28 /pmc/articles/PMC9266618/ /pubmed/35806154 http://dx.doi.org/10.3390/ijms23137150 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Communication
Fan, Lu
Warnecke, Athanasia
Weder, Julia
Preller, Matthias
Zeilinger, Carsten
Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site
title Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site
title_full Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site
title_fullStr Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site
title_full_unstemmed Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site
title_short Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site
title_sort triiodothyronine acts as a smart influencer on hsp90 via a triiodothyronine binding site
topic Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9266618/
https://www.ncbi.nlm.nih.gov/pubmed/35806154
http://dx.doi.org/10.3390/ijms23137150
work_keys_str_mv AT fanlu triiodothyronineactsasasmartinfluenceronhsp90viaatriiodothyroninebindingsite
AT warneckeathanasia triiodothyronineactsasasmartinfluenceronhsp90viaatriiodothyroninebindingsite
AT wederjulia triiodothyronineactsasasmartinfluenceronhsp90viaatriiodothyroninebindingsite
AT prellermatthias triiodothyronineactsasasmartinfluenceronhsp90viaatriiodothyroninebindingsite
AT zeilingercarsten triiodothyronineactsasasmartinfluenceronhsp90viaatriiodothyroninebindingsite

Ejemplares similares