Cargando…

A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology

Insulin-induced GLUT4 translocation to the plasma membrane in muscle and adipocytes is crucial for whole-body glucose homeostasis. Currently, GLUT4 trafficking assays rely on overexpression of tagged GLUT4. Here we describe a high-content imaging platform for studying endogenous GLUT4 translocation...

Descripción completa

Detalles Bibliográficos
Autores principales: Diaz-Vegas, Alexis, Norris, Dougall M, Jall-Rogg, Sigrid, Cooke, Kristen C, Conway, Olivia J, Shun-Shion, Amber S, Duan, Xiaowen, Potter, Meg, van Gerwen, Julian, Baird, Harry JM, Humphrey, Sean J, James, David E, Fazakerley, Daniel J, Burchfield, James G
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Life Science Alliance LLC 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9595207/
https://www.ncbi.nlm.nih.gov/pubmed/36283703
http://dx.doi.org/10.26508/lsa.202201585
_version_ 1784815594489511936
author Diaz-Vegas, Alexis
Norris, Dougall M
Jall-Rogg, Sigrid
Cooke, Kristen C
Conway, Olivia J
Shun-Shion, Amber S
Duan, Xiaowen
Potter, Meg
van Gerwen, Julian
Baird, Harry JM
Humphrey, Sean J
James, David E
Fazakerley, Daniel J
Burchfield, James G
author_facet Diaz-Vegas, Alexis
Norris, Dougall M
Jall-Rogg, Sigrid
Cooke, Kristen C
Conway, Olivia J
Shun-Shion, Amber S
Duan, Xiaowen
Potter, Meg
van Gerwen, Julian
Baird, Harry JM
Humphrey, Sean J
James, David E
Fazakerley, Daniel J
Burchfield, James G
author_sort Diaz-Vegas, Alexis
collection PubMed
description Insulin-induced GLUT4 translocation to the plasma membrane in muscle and adipocytes is crucial for whole-body glucose homeostasis. Currently, GLUT4 trafficking assays rely on overexpression of tagged GLUT4. Here we describe a high-content imaging platform for studying endogenous GLUT4 translocation in intact adipocytes. This method enables high fidelity analysis of GLUT4 responses to specific perturbations, multiplexing of other trafficking proteins and other features including lipid droplet morphology. Using this multiplexed approach we showed that Vps45 and Rab14 are selective regulators of GLUT4, but Trarg1, Stx6, Stx16, Tbc1d4 and Rab10 knockdown affected both GLUT4 and TfR translocation. Thus, GLUT4 and TfR translocation machinery likely have some overlap upon insulin-stimulation. In addition, we identified Kif13A, a Rab10 binding molecular motor, as a novel regulator of GLUT4 traffic. Finally, comparison of endogenous to overexpressed GLUT4 highlights that the endogenous GLUT4 methodology has an enhanced sensitivity to genetic perturbations and emphasises the advantage of studying endogenous protein trafficking for drug discovery and genetic analysis of insulin action in relevant cell types.
format Online
Article
Text
id pubmed-9595207
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Life Science Alliance LLC
record_format MEDLINE/PubMed
spelling pubmed-95952072022-10-26 A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology Diaz-Vegas, Alexis Norris, Dougall M Jall-Rogg, Sigrid Cooke, Kristen C Conway, Olivia J Shun-Shion, Amber S Duan, Xiaowen Potter, Meg van Gerwen, Julian Baird, Harry JM Humphrey, Sean J James, David E Fazakerley, Daniel J Burchfield, James G Life Sci Alliance Methods Insulin-induced GLUT4 translocation to the plasma membrane in muscle and adipocytes is crucial for whole-body glucose homeostasis. Currently, GLUT4 trafficking assays rely on overexpression of tagged GLUT4. Here we describe a high-content imaging platform for studying endogenous GLUT4 translocation in intact adipocytes. This method enables high fidelity analysis of GLUT4 responses to specific perturbations, multiplexing of other trafficking proteins and other features including lipid droplet morphology. Using this multiplexed approach we showed that Vps45 and Rab14 are selective regulators of GLUT4, but Trarg1, Stx6, Stx16, Tbc1d4 and Rab10 knockdown affected both GLUT4 and TfR translocation. Thus, GLUT4 and TfR translocation machinery likely have some overlap upon insulin-stimulation. In addition, we identified Kif13A, a Rab10 binding molecular motor, as a novel regulator of GLUT4 traffic. Finally, comparison of endogenous to overexpressed GLUT4 highlights that the endogenous GLUT4 methodology has an enhanced sensitivity to genetic perturbations and emphasises the advantage of studying endogenous protein trafficking for drug discovery and genetic analysis of insulin action in relevant cell types. Life Science Alliance LLC 2022-10-25 /pmc/articles/PMC9595207/ /pubmed/36283703 http://dx.doi.org/10.26508/lsa.202201585 Text en © 2022 Diaz-Vegas et al. https://creativecommons.org/licenses/by/4.0/This article is available under a Creative Commons License (Attribution 4.0 International, as described at https://creativecommons.org/licenses/by/4.0/).
spellingShingle Methods
Diaz-Vegas, Alexis
Norris, Dougall M
Jall-Rogg, Sigrid
Cooke, Kristen C
Conway, Olivia J
Shun-Shion, Amber S
Duan, Xiaowen
Potter, Meg
van Gerwen, Julian
Baird, Harry JM
Humphrey, Sean J
James, David E
Fazakerley, Daniel J
Burchfield, James G
A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology
title A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology
title_full A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology
title_fullStr A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology
title_full_unstemmed A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology
title_short A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology
title_sort high-content endogenous glut4 trafficking assay reveals new aspects of adipocyte biology
topic Methods
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9595207/
https://www.ncbi.nlm.nih.gov/pubmed/36283703
http://dx.doi.org/10.26508/lsa.202201585
work_keys_str_mv AT diazvegasalexis ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT norrisdougallm ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT jallroggsigrid ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT cookekristenc ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT conwayoliviaj ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT shunshionambers ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT duanxiaowen ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT pottermeg ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT vangerwenjulian ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT bairdharryjm ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT humphreyseanj ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT jamesdavide ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT fazakerleydanielj ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT burchfieldjamesg ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT diazvegasalexis highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT norrisdougallm highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT jallroggsigrid highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT cookekristenc highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT conwayoliviaj highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT shunshionambers highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT duanxiaowen highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT pottermeg highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT vangerwenjulian highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT bairdharryjm highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT humphreyseanj highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT jamesdavide highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT fazakerleydanielj highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology
AT burchfieldjamesg highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology