Cargando…
A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology
Insulin-induced GLUT4 translocation to the plasma membrane in muscle and adipocytes is crucial for whole-body glucose homeostasis. Currently, GLUT4 trafficking assays rely on overexpression of tagged GLUT4. Here we describe a high-content imaging platform for studying endogenous GLUT4 translocation...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Life Science Alliance LLC
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9595207/ https://www.ncbi.nlm.nih.gov/pubmed/36283703 http://dx.doi.org/10.26508/lsa.202201585 |
_version_ | 1784815594489511936 |
---|---|
author | Diaz-Vegas, Alexis Norris, Dougall M Jall-Rogg, Sigrid Cooke, Kristen C Conway, Olivia J Shun-Shion, Amber S Duan, Xiaowen Potter, Meg van Gerwen, Julian Baird, Harry JM Humphrey, Sean J James, David E Fazakerley, Daniel J Burchfield, James G |
author_facet | Diaz-Vegas, Alexis Norris, Dougall M Jall-Rogg, Sigrid Cooke, Kristen C Conway, Olivia J Shun-Shion, Amber S Duan, Xiaowen Potter, Meg van Gerwen, Julian Baird, Harry JM Humphrey, Sean J James, David E Fazakerley, Daniel J Burchfield, James G |
author_sort | Diaz-Vegas, Alexis |
collection | PubMed |
description | Insulin-induced GLUT4 translocation to the plasma membrane in muscle and adipocytes is crucial for whole-body glucose homeostasis. Currently, GLUT4 trafficking assays rely on overexpression of tagged GLUT4. Here we describe a high-content imaging platform for studying endogenous GLUT4 translocation in intact adipocytes. This method enables high fidelity analysis of GLUT4 responses to specific perturbations, multiplexing of other trafficking proteins and other features including lipid droplet morphology. Using this multiplexed approach we showed that Vps45 and Rab14 are selective regulators of GLUT4, but Trarg1, Stx6, Stx16, Tbc1d4 and Rab10 knockdown affected both GLUT4 and TfR translocation. Thus, GLUT4 and TfR translocation machinery likely have some overlap upon insulin-stimulation. In addition, we identified Kif13A, a Rab10 binding molecular motor, as a novel regulator of GLUT4 traffic. Finally, comparison of endogenous to overexpressed GLUT4 highlights that the endogenous GLUT4 methodology has an enhanced sensitivity to genetic perturbations and emphasises the advantage of studying endogenous protein trafficking for drug discovery and genetic analysis of insulin action in relevant cell types. |
format | Online Article Text |
id | pubmed-9595207 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Life Science Alliance LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-95952072022-10-26 A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology Diaz-Vegas, Alexis Norris, Dougall M Jall-Rogg, Sigrid Cooke, Kristen C Conway, Olivia J Shun-Shion, Amber S Duan, Xiaowen Potter, Meg van Gerwen, Julian Baird, Harry JM Humphrey, Sean J James, David E Fazakerley, Daniel J Burchfield, James G Life Sci Alliance Methods Insulin-induced GLUT4 translocation to the plasma membrane in muscle and adipocytes is crucial for whole-body glucose homeostasis. Currently, GLUT4 trafficking assays rely on overexpression of tagged GLUT4. Here we describe a high-content imaging platform for studying endogenous GLUT4 translocation in intact adipocytes. This method enables high fidelity analysis of GLUT4 responses to specific perturbations, multiplexing of other trafficking proteins and other features including lipid droplet morphology. Using this multiplexed approach we showed that Vps45 and Rab14 are selective regulators of GLUT4, but Trarg1, Stx6, Stx16, Tbc1d4 and Rab10 knockdown affected both GLUT4 and TfR translocation. Thus, GLUT4 and TfR translocation machinery likely have some overlap upon insulin-stimulation. In addition, we identified Kif13A, a Rab10 binding molecular motor, as a novel regulator of GLUT4 traffic. Finally, comparison of endogenous to overexpressed GLUT4 highlights that the endogenous GLUT4 methodology has an enhanced sensitivity to genetic perturbations and emphasises the advantage of studying endogenous protein trafficking for drug discovery and genetic analysis of insulin action in relevant cell types. Life Science Alliance LLC 2022-10-25 /pmc/articles/PMC9595207/ /pubmed/36283703 http://dx.doi.org/10.26508/lsa.202201585 Text en © 2022 Diaz-Vegas et al. https://creativecommons.org/licenses/by/4.0/This article is available under a Creative Commons License (Attribution 4.0 International, as described at https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Methods Diaz-Vegas, Alexis Norris, Dougall M Jall-Rogg, Sigrid Cooke, Kristen C Conway, Olivia J Shun-Shion, Amber S Duan, Xiaowen Potter, Meg van Gerwen, Julian Baird, Harry JM Humphrey, Sean J James, David E Fazakerley, Daniel J Burchfield, James G A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology |
title | A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology |
title_full | A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology |
title_fullStr | A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology |
title_full_unstemmed | A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology |
title_short | A high-content endogenous GLUT4 trafficking assay reveals new aspects of adipocyte biology |
title_sort | high-content endogenous glut4 trafficking assay reveals new aspects of adipocyte biology |
topic | Methods |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9595207/ https://www.ncbi.nlm.nih.gov/pubmed/36283703 http://dx.doi.org/10.26508/lsa.202201585 |
work_keys_str_mv | AT diazvegasalexis ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT norrisdougallm ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT jallroggsigrid ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT cookekristenc ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT conwayoliviaj ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT shunshionambers ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT duanxiaowen ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT pottermeg ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT vangerwenjulian ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT bairdharryjm ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT humphreyseanj ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT jamesdavide ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT fazakerleydanielj ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT burchfieldjamesg ahighcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT diazvegasalexis highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT norrisdougallm highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT jallroggsigrid highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT cookekristenc highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT conwayoliviaj highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT shunshionambers highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT duanxiaowen highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT pottermeg highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT vangerwenjulian highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT bairdharryjm highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT humphreyseanj highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT jamesdavide highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT fazakerleydanielj highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology AT burchfieldjamesg highcontentendogenousglut4traffickingassayrevealsnewaspectsofadipocytebiology |