Cargando…

Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene

Background: The biological role of EGFRvIII (epidermal growth factor receptor variant three) remains unclear. Methods: Three glioblastoma DK-MG sublines were tested with EGF (epidermal growth factor) and TGFβ (transforming growth factor β). Sublines were characterized by an increased percentage of E...

Descripción completa

Detalles Bibliográficos
Autores principales: Włodarczyk, Aneta, Tręda, Cezary, Rutkowska, Adrianna, Grot, Dagmara, Dobrewa, Weronika, Kierasińska, Amelia, Węgierska, Marta, Wasiak, Tomasz, Strózik, Tadeusz, Rieske, Piotr, Stoczyńska-Fidelus, Ewelina
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9603514/
https://www.ncbi.nlm.nih.gov/pubmed/36292985
http://dx.doi.org/10.3390/ijms232012129
_version_ 1784817569644937216
author Włodarczyk, Aneta
Tręda, Cezary
Rutkowska, Adrianna
Grot, Dagmara
Dobrewa, Weronika
Kierasińska, Amelia
Węgierska, Marta
Wasiak, Tomasz
Strózik, Tadeusz
Rieske, Piotr
Stoczyńska-Fidelus, Ewelina
author_facet Włodarczyk, Aneta
Tręda, Cezary
Rutkowska, Adrianna
Grot, Dagmara
Dobrewa, Weronika
Kierasińska, Amelia
Węgierska, Marta
Wasiak, Tomasz
Strózik, Tadeusz
Rieske, Piotr
Stoczyńska-Fidelus, Ewelina
author_sort Włodarczyk, Aneta
collection PubMed
description Background: The biological role of EGFRvIII (epidermal growth factor receptor variant three) remains unclear. Methods: Three glioblastoma DK-MG sublines were tested with EGF (epidermal growth factor) and TGFβ (transforming growth factor β). Sublines were characterized by an increased percentage of EGFRvIII-positive cells and doubling time (DK-MG(low) to DK-MG(extra-high)), number of amplicons, and EGFRvIII mRNA expression. The influence of the growth factors on primary EGFRvIII positive glioblastomas was assessed. Results: The overexpression of exoEGFRvIII in DK-MG(high) did not convert them into DK-MG(extra-high), and this overexpression did not change DK-MG(low) to DK-MG(high); however, the overexpression of RAS(G12V) increased the proliferation of DK-MG(low). Moreover, the highest EGFRvIII phosphorylation in DK-MG(extra-high) did not cause relevant AKT (known as protein kinase B) and ERK (extracellular signal-regulated kinase) activation. Further analyses indicate that TGFβ is able to induce apoptosis of DK-MG(high) cells. This subline was able to convert to DK-MG(extra-high), which appeared resistant to this proapoptotic effect. EGF acted as a pro-survival factor and stimulated proliferation; however, simultaneous senescence induction in DK-MG(extra-high) cells was ambiguous. Primary EGFRvIII positive (and SOX2 (SRY-Box Transcription Factor 2) positive or SOX2 negative) glioblastoma cells differentially responded to EGF and TGFβ. Conclusions: The roles of TGFβ and EGF in the EGFRvIII context remain unclear. EGFRvIII appears as a weak oncogene and not a marker of GSC (glioma stem cells). Hence, it may not be a proper target for CAR-T (chimeric antigen receptor T cells).
format Online
Article
Text
id pubmed-9603514
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-96035142022-10-27 Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene Włodarczyk, Aneta Tręda, Cezary Rutkowska, Adrianna Grot, Dagmara Dobrewa, Weronika Kierasińska, Amelia Węgierska, Marta Wasiak, Tomasz Strózik, Tadeusz Rieske, Piotr Stoczyńska-Fidelus, Ewelina Int J Mol Sci Article Background: The biological role of EGFRvIII (epidermal growth factor receptor variant three) remains unclear. Methods: Three glioblastoma DK-MG sublines were tested with EGF (epidermal growth factor) and TGFβ (transforming growth factor β). Sublines were characterized by an increased percentage of EGFRvIII-positive cells and doubling time (DK-MG(low) to DK-MG(extra-high)), number of amplicons, and EGFRvIII mRNA expression. The influence of the growth factors on primary EGFRvIII positive glioblastomas was assessed. Results: The overexpression of exoEGFRvIII in DK-MG(high) did not convert them into DK-MG(extra-high), and this overexpression did not change DK-MG(low) to DK-MG(high); however, the overexpression of RAS(G12V) increased the proliferation of DK-MG(low). Moreover, the highest EGFRvIII phosphorylation in DK-MG(extra-high) did not cause relevant AKT (known as protein kinase B) and ERK (extracellular signal-regulated kinase) activation. Further analyses indicate that TGFβ is able to induce apoptosis of DK-MG(high) cells. This subline was able to convert to DK-MG(extra-high), which appeared resistant to this proapoptotic effect. EGF acted as a pro-survival factor and stimulated proliferation; however, simultaneous senescence induction in DK-MG(extra-high) cells was ambiguous. Primary EGFRvIII positive (and SOX2 (SRY-Box Transcription Factor 2) positive or SOX2 negative) glioblastoma cells differentially responded to EGF and TGFβ. Conclusions: The roles of TGFβ and EGF in the EGFRvIII context remain unclear. EGFRvIII appears as a weak oncogene and not a marker of GSC (glioma stem cells). Hence, it may not be a proper target for CAR-T (chimeric antigen receptor T cells). MDPI 2022-10-12 /pmc/articles/PMC9603514/ /pubmed/36292985 http://dx.doi.org/10.3390/ijms232012129 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Włodarczyk, Aneta
Tręda, Cezary
Rutkowska, Adrianna
Grot, Dagmara
Dobrewa, Weronika
Kierasińska, Amelia
Węgierska, Marta
Wasiak, Tomasz
Strózik, Tadeusz
Rieske, Piotr
Stoczyńska-Fidelus, Ewelina
Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene
title Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene
title_full Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene
title_fullStr Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene
title_full_unstemmed Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene
title_short Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene
title_sort phenotypical flexibility of the egfrviii-positive glioblastoma cell line and the multidirectional influence of tgfβ and egf on these cells—egfrviii appears as a weak oncogene
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9603514/
https://www.ncbi.nlm.nih.gov/pubmed/36292985
http://dx.doi.org/10.3390/ijms232012129
work_keys_str_mv AT włodarczykaneta phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT tredacezary phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT rutkowskaadrianna phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT grotdagmara phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT dobrewaweronika phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT kierasinskaamelia phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT wegierskamarta phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT wasiaktomasz phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT stroziktadeusz phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT rieskepiotr phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene
AT stoczynskafidelusewelina phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene