Cargando…
Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene
Background: The biological role of EGFRvIII (epidermal growth factor receptor variant three) remains unclear. Methods: Three glioblastoma DK-MG sublines were tested with EGF (epidermal growth factor) and TGFβ (transforming growth factor β). Sublines were characterized by an increased percentage of E...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9603514/ https://www.ncbi.nlm.nih.gov/pubmed/36292985 http://dx.doi.org/10.3390/ijms232012129 |
_version_ | 1784817569644937216 |
---|---|
author | Włodarczyk, Aneta Tręda, Cezary Rutkowska, Adrianna Grot, Dagmara Dobrewa, Weronika Kierasińska, Amelia Węgierska, Marta Wasiak, Tomasz Strózik, Tadeusz Rieske, Piotr Stoczyńska-Fidelus, Ewelina |
author_facet | Włodarczyk, Aneta Tręda, Cezary Rutkowska, Adrianna Grot, Dagmara Dobrewa, Weronika Kierasińska, Amelia Węgierska, Marta Wasiak, Tomasz Strózik, Tadeusz Rieske, Piotr Stoczyńska-Fidelus, Ewelina |
author_sort | Włodarczyk, Aneta |
collection | PubMed |
description | Background: The biological role of EGFRvIII (epidermal growth factor receptor variant three) remains unclear. Methods: Three glioblastoma DK-MG sublines were tested with EGF (epidermal growth factor) and TGFβ (transforming growth factor β). Sublines were characterized by an increased percentage of EGFRvIII-positive cells and doubling time (DK-MG(low) to DK-MG(extra-high)), number of amplicons, and EGFRvIII mRNA expression. The influence of the growth factors on primary EGFRvIII positive glioblastomas was assessed. Results: The overexpression of exoEGFRvIII in DK-MG(high) did not convert them into DK-MG(extra-high), and this overexpression did not change DK-MG(low) to DK-MG(high); however, the overexpression of RAS(G12V) increased the proliferation of DK-MG(low). Moreover, the highest EGFRvIII phosphorylation in DK-MG(extra-high) did not cause relevant AKT (known as protein kinase B) and ERK (extracellular signal-regulated kinase) activation. Further analyses indicate that TGFβ is able to induce apoptosis of DK-MG(high) cells. This subline was able to convert to DK-MG(extra-high), which appeared resistant to this proapoptotic effect. EGF acted as a pro-survival factor and stimulated proliferation; however, simultaneous senescence induction in DK-MG(extra-high) cells was ambiguous. Primary EGFRvIII positive (and SOX2 (SRY-Box Transcription Factor 2) positive or SOX2 negative) glioblastoma cells differentially responded to EGF and TGFβ. Conclusions: The roles of TGFβ and EGF in the EGFRvIII context remain unclear. EGFRvIII appears as a weak oncogene and not a marker of GSC (glioma stem cells). Hence, it may not be a proper target for CAR-T (chimeric antigen receptor T cells). |
format | Online Article Text |
id | pubmed-9603514 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-96035142022-10-27 Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene Włodarczyk, Aneta Tręda, Cezary Rutkowska, Adrianna Grot, Dagmara Dobrewa, Weronika Kierasińska, Amelia Węgierska, Marta Wasiak, Tomasz Strózik, Tadeusz Rieske, Piotr Stoczyńska-Fidelus, Ewelina Int J Mol Sci Article Background: The biological role of EGFRvIII (epidermal growth factor receptor variant three) remains unclear. Methods: Three glioblastoma DK-MG sublines were tested with EGF (epidermal growth factor) and TGFβ (transforming growth factor β). Sublines were characterized by an increased percentage of EGFRvIII-positive cells and doubling time (DK-MG(low) to DK-MG(extra-high)), number of amplicons, and EGFRvIII mRNA expression. The influence of the growth factors on primary EGFRvIII positive glioblastomas was assessed. Results: The overexpression of exoEGFRvIII in DK-MG(high) did not convert them into DK-MG(extra-high), and this overexpression did not change DK-MG(low) to DK-MG(high); however, the overexpression of RAS(G12V) increased the proliferation of DK-MG(low). Moreover, the highest EGFRvIII phosphorylation in DK-MG(extra-high) did not cause relevant AKT (known as protein kinase B) and ERK (extracellular signal-regulated kinase) activation. Further analyses indicate that TGFβ is able to induce apoptosis of DK-MG(high) cells. This subline was able to convert to DK-MG(extra-high), which appeared resistant to this proapoptotic effect. EGF acted as a pro-survival factor and stimulated proliferation; however, simultaneous senescence induction in DK-MG(extra-high) cells was ambiguous. Primary EGFRvIII positive (and SOX2 (SRY-Box Transcription Factor 2) positive or SOX2 negative) glioblastoma cells differentially responded to EGF and TGFβ. Conclusions: The roles of TGFβ and EGF in the EGFRvIII context remain unclear. EGFRvIII appears as a weak oncogene and not a marker of GSC (glioma stem cells). Hence, it may not be a proper target for CAR-T (chimeric antigen receptor T cells). MDPI 2022-10-12 /pmc/articles/PMC9603514/ /pubmed/36292985 http://dx.doi.org/10.3390/ijms232012129 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Włodarczyk, Aneta Tręda, Cezary Rutkowska, Adrianna Grot, Dagmara Dobrewa, Weronika Kierasińska, Amelia Węgierska, Marta Wasiak, Tomasz Strózik, Tadeusz Rieske, Piotr Stoczyńska-Fidelus, Ewelina Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene |
title | Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene |
title_full | Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene |
title_fullStr | Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene |
title_full_unstemmed | Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene |
title_short | Phenotypical Flexibility of the EGFRvIII-Positive Glioblastoma Cell Line and the Multidirectional Influence of TGFβ and EGF on These Cells—EGFRvIII Appears as a Weak Oncogene |
title_sort | phenotypical flexibility of the egfrviii-positive glioblastoma cell line and the multidirectional influence of tgfβ and egf on these cells—egfrviii appears as a weak oncogene |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9603514/ https://www.ncbi.nlm.nih.gov/pubmed/36292985 http://dx.doi.org/10.3390/ijms232012129 |
work_keys_str_mv | AT włodarczykaneta phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT tredacezary phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT rutkowskaadrianna phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT grotdagmara phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT dobrewaweronika phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT kierasinskaamelia phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT wegierskamarta phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT wasiaktomasz phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT stroziktadeusz phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT rieskepiotr phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene AT stoczynskafidelusewelina phenotypicalflexibilityoftheegfrviiipositiveglioblastomacelllineandthemultidirectionalinfluenceoftgfbandegfonthesecellsegfrviiiappearsasaweakoncogene |