Cargando…

Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin

Human skin is a preferred vaccination site as it harbors multiple dendritic cell (DC) subsets, which display distinct C‐type lectin receptors (CLR) that recognize pathogens. Antigens can be delivered to CLR by antibodies or ligands to boost antigen‐specific immune responses. This concept has been es...

Descripción completa

Detalles Bibliográficos
Autores principales: Bellmann, Lydia, Strandt, Helen, Zelle‐Rieser, Claudia, Ortner, Daniela, Tripp, Christoph H., Schmid, Sandra, Rühl, Julia, Cappellano, Giuseppe, Schaffenrath, Sandra, Prokopi, Anastasia, Spoeck, Sarah, Seretis, Athanasios, Del Frari, Barbara, Sigl, Stephan, Krapf, Johanna, Heufler, Christine, Keler, Tibor, Münz, Christian, Romani, Nikolaus, Stoitzner, Patrizia
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9788233/
https://www.ncbi.nlm.nih.gov/pubmed/34932821
http://dx.doi.org/10.1002/eji.202149670
_version_ 1784858704682680320
author Bellmann, Lydia
Strandt, Helen
Zelle‐Rieser, Claudia
Ortner, Daniela
Tripp, Christoph H.
Schmid, Sandra
Rühl, Julia
Cappellano, Giuseppe
Schaffenrath, Sandra
Prokopi, Anastasia
Spoeck, Sarah
Seretis, Athanasios
Del Frari, Barbara
Sigl, Stephan
Krapf, Johanna
Heufler, Christine
Keler, Tibor
Münz, Christian
Romani, Nikolaus
Stoitzner, Patrizia
author_facet Bellmann, Lydia
Strandt, Helen
Zelle‐Rieser, Claudia
Ortner, Daniela
Tripp, Christoph H.
Schmid, Sandra
Rühl, Julia
Cappellano, Giuseppe
Schaffenrath, Sandra
Prokopi, Anastasia
Spoeck, Sarah
Seretis, Athanasios
Del Frari, Barbara
Sigl, Stephan
Krapf, Johanna
Heufler, Christine
Keler, Tibor
Münz, Christian
Romani, Nikolaus
Stoitzner, Patrizia
author_sort Bellmann, Lydia
collection PubMed
description Human skin is a preferred vaccination site as it harbors multiple dendritic cell (DC) subsets, which display distinct C‐type lectin receptors (CLR) that recognize pathogens. Antigens can be delivered to CLR by antibodies or ligands to boost antigen‐specific immune responses. This concept has been established in mouse models but detailed insights into the functional consequences of antigen delivery to human skin DC in situ are sparse. In this study, we cloned and produced an anti‐human Langerin antibody conjugated to the EBV nuclear antigen 1 (EBNA1). We confirmed specific binding of anti‐Langerin‐EBNA1 to Langerhans cells (LC). This novel LC‐based vaccine was then compared to an existing anti‐DEC‐205‐EBNA1 fusion protein by loading LC in epidermal cell suspensions before coculturing them with autologous T cells. After restimulation with EBNA1‐peptides, we detected elevated levels of IFN‐γ‐ and TNF‐α‐positive CD4(+) T cells with both vaccines. When we injected the fusion proteins intradermally into human skin explants, emigrated skin DC targeted via DEC‐205‐induced cytokine production by T cells, whereas the Langerin‐based vaccine failed to do so. In summary, we demonstrate that antibody‐targeting approaches via the skin are promising vaccination strategies, however, further optimizations of vaccines are required to induce potent immune responses.
format Online
Article
Text
id pubmed-9788233
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-97882332022-12-28 Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin Bellmann, Lydia Strandt, Helen Zelle‐Rieser, Claudia Ortner, Daniela Tripp, Christoph H. Schmid, Sandra Rühl, Julia Cappellano, Giuseppe Schaffenrath, Sandra Prokopi, Anastasia Spoeck, Sarah Seretis, Athanasios Del Frari, Barbara Sigl, Stephan Krapf, Johanna Heufler, Christine Keler, Tibor Münz, Christian Romani, Nikolaus Stoitzner, Patrizia Eur J Immunol Tissue immunology and leukocyte trafficking Human skin is a preferred vaccination site as it harbors multiple dendritic cell (DC) subsets, which display distinct C‐type lectin receptors (CLR) that recognize pathogens. Antigens can be delivered to CLR by antibodies or ligands to boost antigen‐specific immune responses. This concept has been established in mouse models but detailed insights into the functional consequences of antigen delivery to human skin DC in situ are sparse. In this study, we cloned and produced an anti‐human Langerin antibody conjugated to the EBV nuclear antigen 1 (EBNA1). We confirmed specific binding of anti‐Langerin‐EBNA1 to Langerhans cells (LC). This novel LC‐based vaccine was then compared to an existing anti‐DEC‐205‐EBNA1 fusion protein by loading LC in epidermal cell suspensions before coculturing them with autologous T cells. After restimulation with EBNA1‐peptides, we detected elevated levels of IFN‐γ‐ and TNF‐α‐positive CD4(+) T cells with both vaccines. When we injected the fusion proteins intradermally into human skin explants, emigrated skin DC targeted via DEC‐205‐induced cytokine production by T cells, whereas the Langerin‐based vaccine failed to do so. In summary, we demonstrate that antibody‐targeting approaches via the skin are promising vaccination strategies, however, further optimizations of vaccines are required to induce potent immune responses. John Wiley and Sons Inc. 2022-01-09 2022-11 /pmc/articles/PMC9788233/ /pubmed/34932821 http://dx.doi.org/10.1002/eji.202149670 Text en © 2022 The Authors. European Journal of Immunology published by Wiley‐VCH GmbH https://creativecommons.org/licenses/by/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Tissue immunology and leukocyte trafficking
Bellmann, Lydia
Strandt, Helen
Zelle‐Rieser, Claudia
Ortner, Daniela
Tripp, Christoph H.
Schmid, Sandra
Rühl, Julia
Cappellano, Giuseppe
Schaffenrath, Sandra
Prokopi, Anastasia
Spoeck, Sarah
Seretis, Athanasios
Del Frari, Barbara
Sigl, Stephan
Krapf, Johanna
Heufler, Christine
Keler, Tibor
Münz, Christian
Romani, Nikolaus
Stoitzner, Patrizia
Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin
title Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin
title_full Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin
title_fullStr Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin
title_full_unstemmed Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin
title_short Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin
title_sort targeted delivery of a vaccine protein to langerhans cells in the human skin via the c‐type lectin receptor langerin
topic Tissue immunology and leukocyte trafficking
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9788233/
https://www.ncbi.nlm.nih.gov/pubmed/34932821
http://dx.doi.org/10.1002/eji.202149670
work_keys_str_mv AT bellmannlydia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT strandthelen targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT zellerieserclaudia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT ortnerdaniela targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT trippchristophh targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT schmidsandra targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT ruhljulia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT cappellanogiuseppe targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT schaffenrathsandra targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT prokopianastasia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT spoecksarah targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT seretisathanasios targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT delfraribarbara targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT siglstephan targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT krapfjohanna targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT heuflerchristine targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT kelertibor targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT munzchristian targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT romaninikolaus targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin
AT stoitznerpatrizia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin