Cargando…
Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin
Human skin is a preferred vaccination site as it harbors multiple dendritic cell (DC) subsets, which display distinct C‐type lectin receptors (CLR) that recognize pathogens. Antigens can be delivered to CLR by antibodies or ligands to boost antigen‐specific immune responses. This concept has been es...
Autores principales: | , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9788233/ https://www.ncbi.nlm.nih.gov/pubmed/34932821 http://dx.doi.org/10.1002/eji.202149670 |
_version_ | 1784858704682680320 |
---|---|
author | Bellmann, Lydia Strandt, Helen Zelle‐Rieser, Claudia Ortner, Daniela Tripp, Christoph H. Schmid, Sandra Rühl, Julia Cappellano, Giuseppe Schaffenrath, Sandra Prokopi, Anastasia Spoeck, Sarah Seretis, Athanasios Del Frari, Barbara Sigl, Stephan Krapf, Johanna Heufler, Christine Keler, Tibor Münz, Christian Romani, Nikolaus Stoitzner, Patrizia |
author_facet | Bellmann, Lydia Strandt, Helen Zelle‐Rieser, Claudia Ortner, Daniela Tripp, Christoph H. Schmid, Sandra Rühl, Julia Cappellano, Giuseppe Schaffenrath, Sandra Prokopi, Anastasia Spoeck, Sarah Seretis, Athanasios Del Frari, Barbara Sigl, Stephan Krapf, Johanna Heufler, Christine Keler, Tibor Münz, Christian Romani, Nikolaus Stoitzner, Patrizia |
author_sort | Bellmann, Lydia |
collection | PubMed |
description | Human skin is a preferred vaccination site as it harbors multiple dendritic cell (DC) subsets, which display distinct C‐type lectin receptors (CLR) that recognize pathogens. Antigens can be delivered to CLR by antibodies or ligands to boost antigen‐specific immune responses. This concept has been established in mouse models but detailed insights into the functional consequences of antigen delivery to human skin DC in situ are sparse. In this study, we cloned and produced an anti‐human Langerin antibody conjugated to the EBV nuclear antigen 1 (EBNA1). We confirmed specific binding of anti‐Langerin‐EBNA1 to Langerhans cells (LC). This novel LC‐based vaccine was then compared to an existing anti‐DEC‐205‐EBNA1 fusion protein by loading LC in epidermal cell suspensions before coculturing them with autologous T cells. After restimulation with EBNA1‐peptides, we detected elevated levels of IFN‐γ‐ and TNF‐α‐positive CD4(+) T cells with both vaccines. When we injected the fusion proteins intradermally into human skin explants, emigrated skin DC targeted via DEC‐205‐induced cytokine production by T cells, whereas the Langerin‐based vaccine failed to do so. In summary, we demonstrate that antibody‐targeting approaches via the skin are promising vaccination strategies, however, further optimizations of vaccines are required to induce potent immune responses. |
format | Online Article Text |
id | pubmed-9788233 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-97882332022-12-28 Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin Bellmann, Lydia Strandt, Helen Zelle‐Rieser, Claudia Ortner, Daniela Tripp, Christoph H. Schmid, Sandra Rühl, Julia Cappellano, Giuseppe Schaffenrath, Sandra Prokopi, Anastasia Spoeck, Sarah Seretis, Athanasios Del Frari, Barbara Sigl, Stephan Krapf, Johanna Heufler, Christine Keler, Tibor Münz, Christian Romani, Nikolaus Stoitzner, Patrizia Eur J Immunol Tissue immunology and leukocyte trafficking Human skin is a preferred vaccination site as it harbors multiple dendritic cell (DC) subsets, which display distinct C‐type lectin receptors (CLR) that recognize pathogens. Antigens can be delivered to CLR by antibodies or ligands to boost antigen‐specific immune responses. This concept has been established in mouse models but detailed insights into the functional consequences of antigen delivery to human skin DC in situ are sparse. In this study, we cloned and produced an anti‐human Langerin antibody conjugated to the EBV nuclear antigen 1 (EBNA1). We confirmed specific binding of anti‐Langerin‐EBNA1 to Langerhans cells (LC). This novel LC‐based vaccine was then compared to an existing anti‐DEC‐205‐EBNA1 fusion protein by loading LC in epidermal cell suspensions before coculturing them with autologous T cells. After restimulation with EBNA1‐peptides, we detected elevated levels of IFN‐γ‐ and TNF‐α‐positive CD4(+) T cells with both vaccines. When we injected the fusion proteins intradermally into human skin explants, emigrated skin DC targeted via DEC‐205‐induced cytokine production by T cells, whereas the Langerin‐based vaccine failed to do so. In summary, we demonstrate that antibody‐targeting approaches via the skin are promising vaccination strategies, however, further optimizations of vaccines are required to induce potent immune responses. John Wiley and Sons Inc. 2022-01-09 2022-11 /pmc/articles/PMC9788233/ /pubmed/34932821 http://dx.doi.org/10.1002/eji.202149670 Text en © 2022 The Authors. European Journal of Immunology published by Wiley‐VCH GmbH https://creativecommons.org/licenses/by/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Tissue immunology and leukocyte trafficking Bellmann, Lydia Strandt, Helen Zelle‐Rieser, Claudia Ortner, Daniela Tripp, Christoph H. Schmid, Sandra Rühl, Julia Cappellano, Giuseppe Schaffenrath, Sandra Prokopi, Anastasia Spoeck, Sarah Seretis, Athanasios Del Frari, Barbara Sigl, Stephan Krapf, Johanna Heufler, Christine Keler, Tibor Münz, Christian Romani, Nikolaus Stoitzner, Patrizia Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin |
title | Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin |
title_full | Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin |
title_fullStr | Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin |
title_full_unstemmed | Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin |
title_short | Targeted delivery of a vaccine protein to Langerhans cells in the human skin via the C‐type lectin receptor Langerin |
title_sort | targeted delivery of a vaccine protein to langerhans cells in the human skin via the c‐type lectin receptor langerin |
topic | Tissue immunology and leukocyte trafficking |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9788233/ https://www.ncbi.nlm.nih.gov/pubmed/34932821 http://dx.doi.org/10.1002/eji.202149670 |
work_keys_str_mv | AT bellmannlydia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT strandthelen targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT zellerieserclaudia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT ortnerdaniela targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT trippchristophh targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT schmidsandra targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT ruhljulia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT cappellanogiuseppe targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT schaffenrathsandra targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT prokopianastasia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT spoecksarah targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT seretisathanasios targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT delfraribarbara targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT siglstephan targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT krapfjohanna targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT heuflerchristine targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT kelertibor targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT munzchristian targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT romaninikolaus targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin AT stoitznerpatrizia targeteddeliveryofavaccineproteintolangerhanscellsinthehumanskinviathectypelectinreceptorlangerin |