Cargando…
In Vitro Experimental Assessment of Ethanolic Extract of Moringa oleifera Leaves as an α-Amylase and α-Lipase Inhibitor
METHODS: Phytochemical screening, antioxidant activity, α-amylase, and α-lipase inhibitory assessment were carried out on Moringa oleifera extract. RESULTS: The result of the phytochemical screening revealed the presence of total phenolic, flavonoid, tannin, and alkaloid contents of values 0.070 ± 0...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9815922/ https://www.ncbi.nlm.nih.gov/pubmed/36620201 http://dx.doi.org/10.1155/2022/4613109 |
_version_ | 1784864419930439680 |
---|---|
author | Ogundipe, Adebanke Adetuyi, Babatunde Iheagwam, Franklyn Adefoyeke, Keleko Olugbuyiro, Joseph Ogunlana, Oluseyi Ogunlana, Olubanke |
author_facet | Ogundipe, Adebanke Adetuyi, Babatunde Iheagwam, Franklyn Adefoyeke, Keleko Olugbuyiro, Joseph Ogunlana, Oluseyi Ogunlana, Olubanke |
author_sort | Ogundipe, Adebanke |
collection | PubMed |
description | METHODS: Phytochemical screening, antioxidant activity, α-amylase, and α-lipase inhibitory assessment were carried out on Moringa oleifera extract. RESULTS: The result of the phytochemical screening revealed the presence of total phenolic, flavonoid, tannin, and alkaloid contents of values 0.070 ± 0.005 mg gallic acid equivalent/g, 0.180 ± 0.020 mg rutin equivalent/g, 0.042 ± 0.001 mg tannic equivalent/g, and 12.17 ± 0.001%, respectively, while the total protein analysis was 0.475 ± 0.001 mg bovine serum albumin equivalent/g. Ferric reducing antioxidant power (FRAP) and total antioxidant capacity (TAC) values were 0.534 ± 0.001 mg gallic acid equivalent/g and 0.022 ± 0.00008 mg rutin equivalent/g, respectively. Diphenyl-2-picrylhydrazyl (DPPH), ABTS (2,2′-azino-bis (ethylbenzothiazoline-6-sulfonic acid)), and nitric oxide (NO) assays showed the extract to have a strong free radical scavenging activity. The 50% inhibitory concentration (IC(50)) values of the lipase and amylase activities of the extract are 1.0877 mg/mL and 0.1802 mg/mL, respectively. CONCLUSION: However, α-lipase and α-amylase inhibiting activity of M. oleifera could be related to the phytochemicals in the extract. This research validates the ethnobotanical use of M. oleifera leaves as an effective plant-based therapeutic agent for diabetes and obesity. |
format | Online Article Text |
id | pubmed-9815922 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-98159222023-01-06 In Vitro Experimental Assessment of Ethanolic Extract of Moringa oleifera Leaves as an α-Amylase and α-Lipase Inhibitor Ogundipe, Adebanke Adetuyi, Babatunde Iheagwam, Franklyn Adefoyeke, Keleko Olugbuyiro, Joseph Ogunlana, Oluseyi Ogunlana, Olubanke Biochem Res Int Research Article METHODS: Phytochemical screening, antioxidant activity, α-amylase, and α-lipase inhibitory assessment were carried out on Moringa oleifera extract. RESULTS: The result of the phytochemical screening revealed the presence of total phenolic, flavonoid, tannin, and alkaloid contents of values 0.070 ± 0.005 mg gallic acid equivalent/g, 0.180 ± 0.020 mg rutin equivalent/g, 0.042 ± 0.001 mg tannic equivalent/g, and 12.17 ± 0.001%, respectively, while the total protein analysis was 0.475 ± 0.001 mg bovine serum albumin equivalent/g. Ferric reducing antioxidant power (FRAP) and total antioxidant capacity (TAC) values were 0.534 ± 0.001 mg gallic acid equivalent/g and 0.022 ± 0.00008 mg rutin equivalent/g, respectively. Diphenyl-2-picrylhydrazyl (DPPH), ABTS (2,2′-azino-bis (ethylbenzothiazoline-6-sulfonic acid)), and nitric oxide (NO) assays showed the extract to have a strong free radical scavenging activity. The 50% inhibitory concentration (IC(50)) values of the lipase and amylase activities of the extract are 1.0877 mg/mL and 0.1802 mg/mL, respectively. CONCLUSION: However, α-lipase and α-amylase inhibiting activity of M. oleifera could be related to the phytochemicals in the extract. This research validates the ethnobotanical use of M. oleifera leaves as an effective plant-based therapeutic agent for diabetes and obesity. Hindawi 2022-12-29 /pmc/articles/PMC9815922/ /pubmed/36620201 http://dx.doi.org/10.1155/2022/4613109 Text en Copyright © 2022 Adebanke Ogundipe et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Ogundipe, Adebanke Adetuyi, Babatunde Iheagwam, Franklyn Adefoyeke, Keleko Olugbuyiro, Joseph Ogunlana, Oluseyi Ogunlana, Olubanke In Vitro Experimental Assessment of Ethanolic Extract of Moringa oleifera Leaves as an α-Amylase and α-Lipase Inhibitor |
title |
In Vitro Experimental Assessment of Ethanolic Extract of Moringa oleifera Leaves as an α-Amylase and α-Lipase Inhibitor |
title_full |
In Vitro Experimental Assessment of Ethanolic Extract of Moringa oleifera Leaves as an α-Amylase and α-Lipase Inhibitor |
title_fullStr |
In Vitro Experimental Assessment of Ethanolic Extract of Moringa oleifera Leaves as an α-Amylase and α-Lipase Inhibitor |
title_full_unstemmed |
In Vitro Experimental Assessment of Ethanolic Extract of Moringa oleifera Leaves as an α-Amylase and α-Lipase Inhibitor |
title_short |
In Vitro Experimental Assessment of Ethanolic Extract of Moringa oleifera Leaves as an α-Amylase and α-Lipase Inhibitor |
title_sort | in vitro experimental assessment of ethanolic extract of moringa oleifera leaves as an α-amylase and α-lipase inhibitor |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9815922/ https://www.ncbi.nlm.nih.gov/pubmed/36620201 http://dx.doi.org/10.1155/2022/4613109 |
work_keys_str_mv | AT ogundipeadebanke invitroexperimentalassessmentofethanolicextractofmoringaoleiferaleavesasanaamylaseandalipaseinhibitor AT adetuyibabatunde invitroexperimentalassessmentofethanolicextractofmoringaoleiferaleavesasanaamylaseandalipaseinhibitor AT iheagwamfranklyn invitroexperimentalassessmentofethanolicextractofmoringaoleiferaleavesasanaamylaseandalipaseinhibitor AT adefoyekekeleko invitroexperimentalassessmentofethanolicextractofmoringaoleiferaleavesasanaamylaseandalipaseinhibitor AT olugbuyirojoseph invitroexperimentalassessmentofethanolicextractofmoringaoleiferaleavesasanaamylaseandalipaseinhibitor AT ogunlanaoluseyi invitroexperimentalassessmentofethanolicextractofmoringaoleiferaleavesasanaamylaseandalipaseinhibitor AT ogunlanaolubanke invitroexperimentalassessmentofethanolicextractofmoringaoleiferaleavesasanaamylaseandalipaseinhibitor |