Cargando…
NMDARs antagonist MK801 suppresses LPS-induced apoptosis and mitochondrial dysfunction by regulating subunits of NMDARs via the CaM/CaMKII/ERK pathway
Lipopolysaccharide (LPS) displays a robust immunostimulatory ability upon Toll-like receptor 4 (TLR4) recognition. N-methyl-D-aspartate receptors (NMDARs) are highly compartmentalized in most cells and implicated in various inflammatory disorders. However, the relationship between TLR4 and NMDARs ha...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9922289/ https://www.ncbi.nlm.nih.gov/pubmed/36774369 http://dx.doi.org/10.1038/s41420-023-01362-9 |
_version_ | 1784887512300257280 |
---|---|
author | Han, Wei-Min Hao, Xiao-Bin Hong, Yi-Xiang Zhao, Shan-Shan Chen, Xu-Chang Wang, Ruiying Wang, Yan Li, Gang |
author_facet | Han, Wei-Min Hao, Xiao-Bin Hong, Yi-Xiang Zhao, Shan-Shan Chen, Xu-Chang Wang, Ruiying Wang, Yan Li, Gang |
author_sort | Han, Wei-Min |
collection | PubMed |
description | Lipopolysaccharide (LPS) displays a robust immunostimulatory ability upon Toll-like receptor 4 (TLR4) recognition. N-methyl-D-aspartate receptors (NMDARs) are highly compartmentalized in most cells and implicated in various inflammatory disorders. However, the relationship between TLR4 and NMDARs has not been explored deeply. This study aimed to examine the role of NMDARs and its specific inhibitor MK801 in LPS-treated endothelial cell dysfunction and the related mechanism in vivo and in vitro. The results showed that pre-treatment with MK801 significantly decreased LPS-induced cell death, cellular Ca(2+), cellular reactive oxygen species, and glutamate efflux. Moreover, MK801 restrained LPS-induced mitochondrial dysfunction by regulating mitochondrial membrane potential and mitochondrial Ca(2+) uptake. The oxygen consumption, basal and maximal respiration rate, and ATP production in LPS-treated HUVECs were reversed by MK801 via regulating ATP synthesis-related protein SDHB2, MTCO1, and ATP5A. The molecular pathway involved in MK801-regulated LPS injury was mediated by phosphorylation of CaMKII and ERK and the expression of MCU, MCUR1, and TLR4. LPS-decreased permeability in HUVECs was improved by MK801 via the Erk/ZO-1/occluding/Cx43 axis. Co-immunoprecipitation assay and western blotting showed three subtypes of NMDARs, NMDAζ1, NMDAε2, and NMDAε4 were bound explicitly to TLR4, suppressed by LPS, and promoted by MK801. Deficiency of NMDAζ1, NMDAε2, or NMDAε4 induced cell apoptosis, Ca(2+) uptake, ROS production, and decreased basal and maximal respiration rate, and ATP production, suggesting that NMDARs integrity is vital for cell and mitochondrial function. In vivo investigation showed MK801 improved impairment of vascular permeability, especially in the lung and mesentery in LPS-injured mice. Our study displayed a novel mechanism and utilization of MK801 in LPS-induced ECs injury and permeability. |
format | Online Article Text |
id | pubmed-9922289 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-99222892023-02-13 NMDARs antagonist MK801 suppresses LPS-induced apoptosis and mitochondrial dysfunction by regulating subunits of NMDARs via the CaM/CaMKII/ERK pathway Han, Wei-Min Hao, Xiao-Bin Hong, Yi-Xiang Zhao, Shan-Shan Chen, Xu-Chang Wang, Ruiying Wang, Yan Li, Gang Cell Death Discov Article Lipopolysaccharide (LPS) displays a robust immunostimulatory ability upon Toll-like receptor 4 (TLR4) recognition. N-methyl-D-aspartate receptors (NMDARs) are highly compartmentalized in most cells and implicated in various inflammatory disorders. However, the relationship between TLR4 and NMDARs has not been explored deeply. This study aimed to examine the role of NMDARs and its specific inhibitor MK801 in LPS-treated endothelial cell dysfunction and the related mechanism in vivo and in vitro. The results showed that pre-treatment with MK801 significantly decreased LPS-induced cell death, cellular Ca(2+), cellular reactive oxygen species, and glutamate efflux. Moreover, MK801 restrained LPS-induced mitochondrial dysfunction by regulating mitochondrial membrane potential and mitochondrial Ca(2+) uptake. The oxygen consumption, basal and maximal respiration rate, and ATP production in LPS-treated HUVECs were reversed by MK801 via regulating ATP synthesis-related protein SDHB2, MTCO1, and ATP5A. The molecular pathway involved in MK801-regulated LPS injury was mediated by phosphorylation of CaMKII and ERK and the expression of MCU, MCUR1, and TLR4. LPS-decreased permeability in HUVECs was improved by MK801 via the Erk/ZO-1/occluding/Cx43 axis. Co-immunoprecipitation assay and western blotting showed three subtypes of NMDARs, NMDAζ1, NMDAε2, and NMDAε4 were bound explicitly to TLR4, suppressed by LPS, and promoted by MK801. Deficiency of NMDAζ1, NMDAε2, or NMDAε4 induced cell apoptosis, Ca(2+) uptake, ROS production, and decreased basal and maximal respiration rate, and ATP production, suggesting that NMDARs integrity is vital for cell and mitochondrial function. In vivo investigation showed MK801 improved impairment of vascular permeability, especially in the lung and mesentery in LPS-injured mice. Our study displayed a novel mechanism and utilization of MK801 in LPS-induced ECs injury and permeability. Nature Publishing Group UK 2023-02-11 /pmc/articles/PMC9922289/ /pubmed/36774369 http://dx.doi.org/10.1038/s41420-023-01362-9 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Han, Wei-Min Hao, Xiao-Bin Hong, Yi-Xiang Zhao, Shan-Shan Chen, Xu-Chang Wang, Ruiying Wang, Yan Li, Gang NMDARs antagonist MK801 suppresses LPS-induced apoptosis and mitochondrial dysfunction by regulating subunits of NMDARs via the CaM/CaMKII/ERK pathway |
title | NMDARs antagonist MK801 suppresses LPS-induced apoptosis and mitochondrial dysfunction by regulating subunits of NMDARs via the CaM/CaMKII/ERK pathway |
title_full | NMDARs antagonist MK801 suppresses LPS-induced apoptosis and mitochondrial dysfunction by regulating subunits of NMDARs via the CaM/CaMKII/ERK pathway |
title_fullStr | NMDARs antagonist MK801 suppresses LPS-induced apoptosis and mitochondrial dysfunction by regulating subunits of NMDARs via the CaM/CaMKII/ERK pathway |
title_full_unstemmed | NMDARs antagonist MK801 suppresses LPS-induced apoptosis and mitochondrial dysfunction by regulating subunits of NMDARs via the CaM/CaMKII/ERK pathway |
title_short | NMDARs antagonist MK801 suppresses LPS-induced apoptosis and mitochondrial dysfunction by regulating subunits of NMDARs via the CaM/CaMKII/ERK pathway |
title_sort | nmdars antagonist mk801 suppresses lps-induced apoptosis and mitochondrial dysfunction by regulating subunits of nmdars via the cam/camkii/erk pathway |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9922289/ https://www.ncbi.nlm.nih.gov/pubmed/36774369 http://dx.doi.org/10.1038/s41420-023-01362-9 |
work_keys_str_mv | AT hanweimin nmdarsantagonistmk801suppresseslpsinducedapoptosisandmitochondrialdysfunctionbyregulatingsubunitsofnmdarsviathecamcamkiierkpathway AT haoxiaobin nmdarsantagonistmk801suppresseslpsinducedapoptosisandmitochondrialdysfunctionbyregulatingsubunitsofnmdarsviathecamcamkiierkpathway AT hongyixiang nmdarsantagonistmk801suppresseslpsinducedapoptosisandmitochondrialdysfunctionbyregulatingsubunitsofnmdarsviathecamcamkiierkpathway AT zhaoshanshan nmdarsantagonistmk801suppresseslpsinducedapoptosisandmitochondrialdysfunctionbyregulatingsubunitsofnmdarsviathecamcamkiierkpathway AT chenxuchang nmdarsantagonistmk801suppresseslpsinducedapoptosisandmitochondrialdysfunctionbyregulatingsubunitsofnmdarsviathecamcamkiierkpathway AT wangruiying nmdarsantagonistmk801suppresseslpsinducedapoptosisandmitochondrialdysfunctionbyregulatingsubunitsofnmdarsviathecamcamkiierkpathway AT wangyan nmdarsantagonistmk801suppresseslpsinducedapoptosisandmitochondrialdysfunctionbyregulatingsubunitsofnmdarsviathecamcamkiierkpathway AT ligang nmdarsantagonistmk801suppresseslpsinducedapoptosisandmitochondrialdysfunctionbyregulatingsubunitsofnmdarsviathecamcamkiierkpathway |